ENCAB994YUZ
Antibody against Homo sapiens HES2
Homo sapiens
any cell type or tissue
awaiting characterization
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA039462
- Lot ID
- R36065
- Characterized targets
- HES2 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- hairy and enhancer of split 2 (Drosophila) recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- GLILPLLGREDASGWHTWLPLHAQNCFLLYIQAPEQP
- Aliases
- michael-snyder:784
- External resources