ENCAB949FEQ
Antibody against Drosophila melanogaster cnc
Drosophila melanogaster
any cell type or tissue
awaiting characterization
- Status
- released
- Source (vendor)
- Kevin White
- Product ID
- KW0-CNC
- Lot ID
- unknown
- Characterized targets
- cnc (Drosophila melanogaster)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- Protein A/G
- Antigen description
- Antisera raised against a peptide from the CNC protein. Produced commercially for the modENCODE Project by K. White's group.
- Antigen sequence
- LEEEHLTRDEKRARSLNIPISVPDIINLPMDEFNERLSKYDLSENQLSLIRDIRRRGKNKVAAQNCRKRKLDQILTLEDEVNAVVKRKTQLNQD
- External resources