ENCAB717QXM
Antibody against Homo sapiens GMEB1
Homo sapiens
K562
partially characterized
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA044811
- Lot ID
- R41857
- Characterized targets
- GMEB1 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- glucocorticoid modulatory element binding protein 1 recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- NVVLMPVSTPKPPKRPRLQRPASTTVLSPSPPVQQPQFTVISPITITPVGQSFSMGNIPVATLSQGSSPVTVHTLPSGPQLFRYATVVSS
- Aliases
- michael-snyder:724
- External resources
Characterizations
GMEB1 (Homo sapiens)
K562
Method: immunoprecipitation
compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA044811. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
- Reviewer comment
- Multiple bands but band at expected size is >50% of the total signal in the lane.
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- Exp.800_2-GMEB1.jpg
