ENCAB583UJF
Antibody against Caenorhabditis elegans dot-1.1
Caenorhabditis elegans
at least one cell type or tissue
awaiting characterization
- Status
- released
- Source (vendor)
- SDIX, LLC
- Product ID
- 4868.00.02
- Lot ID
- unknown
- Characterized targets
- dot-1.1 (Caenorhabditis elegans)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Antigen description
- An affinity purified rabbit polyclonal antibody to Y39G10AR.18 obtained from Strategic Diagnostics Inc. (SDIX). Raised against amino acids 763-862 of WP:CE38003. 2.1M long oligo probes in a single array to cover the whole genome of C elegans
- Antigen sequence
- TDVTELLAGSKQIVTQHKGLTNTVAQMENSVAVEEQKLRLIGGPDAVRYFDEAMSHPNVDIAKLTDLVITTRPPNFVAQILLPDDSPTASIDSKVSPSSS
- External resources
Characterizations
dot-1.1 (Caenorhabditis elegans)
Method: knockdown or knockout
not reviewed
- Submitted by
- Jason Lieb
- Lab
- Jason Lieb, UNC
- Grant
- U01HG004270
- Download
- SDQ4129-Y39G10AR18-1247.pdf
dot-1.1 (Caenorhabditis elegans)
Method: immunofluorescence
not reviewed
- Submitted by
- Jason Lieb
- Lab
- Jason Lieb, UNC
- Grant
- U01HG004270
- Download
- SDQ4129-Y39G10AR18-1247.pdf
dot-1.1 (Caenorhabditis elegans)
Method: knockdown or knockout
not reviewed
- Submitted by
- Jason Lieb
- Lab
- Jason Lieb, UNC
- Grant
- U01HG004270