ENCAB385UAF

Antibody against Homo sapiens JARID2

Homo sapiens
endothelial cell of umbilical vein, K562, GM12878
not characterized to standards
Status
released
Source (vendor)
Santa Cruz Biotech
Product ID
sc-134548
Lot ID
1
Characterized targets
JARID2 (Homo sapiens)
Host
rabbit
Clonality
polyclonal
Isotype
IgG
Antigen description
Nuclear transcriptional repressor. Jumonji Antibody (H-260) is a rabbit polyclonal IgG provided at 200 µg/ml. Epitope corresponding to amino acids 961-1220 mapping near the C-terminus of Jumonji of human origin.
Antigen sequence
EDVVHTLLQANGTPGLQMLESNVMISPEVLCKEGIKVHRTVQQSGQFVVCFPGSFVSKVCCGYSVSETVHFATTQWTSMGFETAKEMKRRHIAKPFSMEKLLYQIAQAEAKKENGPTLSTISALLDELRDTELRQRRQLFEAGLHSSARYGSHDGSSTVADGKKKPRKWLQLETSERRCQICQHLCYLSMVVQENENVVFCLECALRHVEKQKSCRGLKLMYRYDEEQIISLVNQICGKVSGKNGSIENCLSKPTPKRGP
Aliases
bradley-bernstein:PchAb 438
External resources

Characterizations

JARID2 (Homo sapiens)
K562GM12878endothelial cell of umbilical vein
Method: immunoblot
Attachment from submitter
not compliant
Caption
Nuclear lysates from GM12878 (10ug),HUVEC (10ug), HepG2 (10ug), were loaded into a 4-12% Bis-Tris gel in 1X MES running buffer. After separation, the samples were transferred to a nitrocellulose membrane using iblot. Membrane was blocked for an hour in room temperature, with 5% BSA in TBS-T and blotted with primary antibody in the appropriate concentration over night at 4c. Membrane was washed and blotted with secondary HRP-conjugated antibody. Detection was made with Optiblot ECL Detect Kit (ab133406) for 2 min. The strongest band detected is of the expected size (~80kDa).
Reviewer comment
KCO: Captions state that expected size should be ~80kDA, yet immunoblot image labels otherwise (shows that it's suppose to be ~150-160kDa). Either way, the strongest band under K562 lane is ~64kDa, which is off in either direction of expected band size.
Submitted by
Noam Shoresh
Lab
Bradley Bernstein, Broad