ENCAB385UAF
Antibody against Homo sapiens JARID2
Homo sapiens
K562, GM12878, endothelial cell of umbilical vein
not characterized to standards
- Status
- released
- Source (vendor)
- Santa Cruz Biotech
- Product ID
- sc-134548
- Lot ID
- 1
- Characterized targets
- JARID2 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Isotype
- IgG
- Antigen description
- Nuclear transcriptional repressor. Jumonji Antibody (H-260) is a rabbit polyclonal IgG provided at 200 µg/ml. Epitope corresponding to amino acids 961-1220 mapping near the C-terminus of Jumonji of human origin.
- Antigen sequence
- EDVVHTLLQANGTPGLQMLESNVMISPEVLCKEGIKVHRTVQQSGQFVVCFPGSFVSKVCCGYSVSETVHFATTQWTSMGFETAKEMKRRHIAKPFSMEKLLYQIAQAEAKKENGPTLSTISALLDELRDTELRQRRQLFEAGLHSSARYGSHDGSSTVADGKKKPRKWLQLETSERRCQICQHLCYLSMVVQENENVVFCLECALRHVEKQKSCRGLKLMYRYDEEQIISLVNQICGKVSGKNGSIENCLSKPTPKRGP
- Aliases
- bradley-bernstein:PchAb 438
- External resources
Characterizations
JARID2 (Homo sapiens)
K562GM12878endothelial cell of umbilical vein
not compliant
- Caption
- Nuclear lysates from GM12878 (10ug),HUVEC (10ug), HepG2 (10ug), were loaded into a 4-12% Bis-Tris gel in 1X MES running buffer. After separation, the samples were transferred to a nitrocellulose membrane using iblot. Membrane was blocked for an hour in room temperature, with 5% BSA in TBS-T and blotted with primary antibody in the appropriate concentration over night at 4c. Membrane was washed and blotted with secondary HRP-conjugated antibody. Detection was made with Optiblot ECL Detect Kit (ab133406) for 2 min. The strongest band detected is of the expected size (~80kDa).
- Reviewer comment
- KCO: Captions state that expected size should be ~80kDA, yet immunoblot image labels otherwise (shows that it's suppose to be ~150-160kDa). Either way, the strongest band under K562 lane is ~64kDa, which is off in either direction of expected band size.
- Submitted by
- Noam Shoresh
- Lab
- Bradley Bernstein, Broad
- Grant
- U54HG006991
- Download
- JARID2_SantaCruz_SC134548X.png