ENCAB336DFB

Antibody against Homo sapiens CREB3L1

Homo sapiens
GM12878, K562
characterized to standards
Homo sapiens
any cell type or tissue
partially characterized
Homo sapiens
HEK293T
not characterized to standards
Status
released
Source (vendor)
Sigma
Product ID
HPA024069
Lot ID
R11037
Characterized targets
CREB3L1 (Homo sapiens)
Host
rabbit
Clonality
polyclonal
Purification
affinity
Isotype
IgG
Antigen description
cAMP-responsive element-binding protein 3-like protein 1 recombinant protein epitope signature tag (PrEST)
Antigen sequence
LNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALGHKLCSIMVKQE
Aliases
michael-snyder:750
External resources

Characterizations

CREB3L1 (Homo sapiens)
GM12878
Method: immunoprecipitation
Attachment from submitter
compliant
Caption
Immunoprecipitation was performed on nuclear extracts from the cell line: GM12878 using the antibody HPA024069. The image shows western blot analysis of input, flowthrough, immunoprecipitate, and mock immunoprecipitate using IgG. Target molecular weight: 57.005.
Reviewer comment
This is detected as a thicker band
Submitted by
Nathaniel Watson
Lab
Michael Snyder, Stanford
CREB3L1 (Homo sapiens)
Method: immunoprecipitation
Attachment from submitter
Caption
Immunoprecipitation was performed on nuclear extracts from the cell line: MCF-7, using the antibody HPA024069. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 57.005
Submitted by
Denis Salins
Lab
Michael Snyder, Stanford
CREB3L1 (Homo sapiens)
K562
Method: immunoprecipitation
Attachment from submitter
compliant
Caption
Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA024069. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
Reviewer comment
Hard to tell given how close it is to the heavy chain but right sized band appears in the input and the band in the IP has a higher signal relative to the IgG around the expected size.
Submitted by
Denis Salins
Lab
Michael Snyder, Stanford
CREB3L1 (Homo sapiens)
Method: motif enrichment
compliant
Caption
The motif for target CREB3L1 is represented by the attached position weight matrix (PWM) derived from ENCFF867IEZ. Motif enrichment analysis was done by Dr. Zhizhuo Zhang (Broad Institute, Kellis Lab). Accept probability score: 0.600848823198!; Global enrichment Z-score: 3.187457175; Positional bias Z-score: 4.982883907; Peak rank bias Z-score: 7.175607979; Enrichment rank: 1.0.
Reviewer comment
The agreed upon cut off is .6 percent accept probability.
Submitted by
Nathaniel Watson
Lab
Michael Snyder, Stanford
CREB3L1 (Homo sapiens)
Method: immunoprecipitation
Attachment from submitter
Caption
Immunoprecipitation was performed on nuclear extracts from the cell line: GM12878, using the antibody HPA024069. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 57.005
Submitted by
Denis Salins
Lab
Michael Snyder, Stanford
CREB3L1 (Homo sapiens)
HEK293T
Method: immunoprecipitation
Attachment from submitter
not compliant
Caption
Immunoprecipitation was performed on nuclear extracts from the cell line: HEK293T, using the antibody HPA024069. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 57.005
Reviewer comment
KCO: IgG has same banding as IP (cannot tell difference between actual antibody-protein interaction to heavy chain of antibody)
Submitted by
Nathaniel Watson
Lab
Michael Snyder, Stanford