ENCAB325TBG
Antibody against Homo sapiens DMTF1
Homo sapiens
HepG2
not characterized to standards
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA023846
- Lot ID
- R11407
- Characterized targets
- DMTF1 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- Cyclin-D-binding Myb-like transcription factor 1 recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- ASPTVTLTAAAPASPEQIIVHALSPEHLLNTSDNVTVQCHTPRVIIQTVATEDITSSISQAELTVDSDIQSSDFPEPPDALEADTFPDEIHHPKMTVEPSFNDAHVSKFSDQNSTELMNSVMVRTEEEI
- Aliases
- michael-snyder:778
- External resources
Characterizations
DMTF1 (Homo sapiens)
HepG2
Method: immunoprecipitation
not compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: HepG2, using the antibody HPA023846. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
- Reviewer comment
- multiple bands, and the major band corresponds to <50% of the total signal in the lane
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- 6.jpg