ENCAB232PLM
Antibody against Drosophila melanogaster Pcl
Drosophila melanogaster
any cell type or tissue
awaiting characterization
- Status
- released
- Source (vendor)
- Kevin White
- Product ID
- non-commercial pcl modENCODE antibody 1
- Lot ID
- unknown
- Characterized targets
- Pcl (Drosophila melanogaster)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- Protein A/G
- Antigen description
- This is a custom polyclonal rabbit antibody against PCL produced by the White Lab for the modENCODE project.
- Antigen sequence
- MPKRVPKDVYEFNTDEDDPVETSEDEIPIKQIIEKAKKQAAQKADKHDELPLKPDLADDNANDGDPGKLPAPIPPLLDANSSRKRKAFRLSKRYDNSRNHCDLSSDENC