ENCAB000BOP
Antibody against Homo sapiens NFKB2
Homo sapiens
K562, GM12878, liver
partially characterized
Homo sapiens
HepG2
not characterized to standards
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA008422
- Lot ID
- A75311
- Characterized targets
- NFKB2 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- Nuclear factor NF-kappa-B p100 subunit recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- LLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEA
- External resources
Characterizations
NFKB2 (Homo sapiens)
GM12878K562HepG2liver
Method: immunoblot
compliant
- Caption
- a) Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order: GM12878, K562, HepG2, Liver using the antibody HPA008422.
- Reviewer comment
- Multiple bands though the one of expected size (~95kD - not indicated) is most prominent.
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- NFKB2_HPA008422_WB_a.jpg
NFKB2 (Homo sapiens)
K562
Method: immunoprecipitation
compliant
- Caption
- b) Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA008422 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG. Expected size 96-97 kDa.
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- NFKB2_HPA008422_WB_b.jpg