ENCAB000BOP

Antibody against Homo sapiens NFKB2

Homo sapiens
liver, K562, GM12878
partially characterized
Homo sapiens
HepG2
not characterized to standards
Status
released
Source (vendor)
Sigma
Product ID
HPA008422
Lot ID
A75311
Characterized targets
NFKB2 (Homo sapiens)
Host
rabbit
Clonality
polyclonal
Purification
affinity
Isotype
IgG
Antigen description
Nuclear factor NF-kappa-B p100 subunit recombinant protein epitope signature tag (PrEST)
Antigen sequence
LLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEA
External resources

Characterizations

NFKB2 (Homo sapiens)
GM12878K562HepG2liver
Method: immunoblot
Attachment from submitter
compliant
Caption
a) Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order: GM12878, K562, HepG2, Liver using the antibody HPA008422.
Reviewer comment
Multiple bands though the one of expected size (~95kD - not indicated) is most prominent.
Submitted by
Trupti Kawli
Lab
Michael Snyder, Stanford
NFKB2 (Homo sapiens)
K562
Method: immunoprecipitation
Attachment from submitter
compliant
Caption
b) Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA008422 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG. Expected size 96-97 kDa.
Submitted by
Trupti Kawli
Lab
Michael Snyder, Stanford