ENCAB000BOL

Antibody against Homo sapiens NFATC2

Homo sapiens
K562
partially characterized
Homo sapiens
GM12878, liver, HepG2
not characterized to standards
Status
released
Source (vendor)
Sigma
Product ID
HPA024369
Lot ID
R12517
Characterized targets
NFATC2 (Homo sapiens)
Host
rabbit
Clonality
polyclonal
Purification
affinity
Isotype
IgG
Antigen description
Nuclear factor of activated T-cells, cytoplasmic 2 recombinant protein epitope signature tag (PrEST)
Antigen sequence
GSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTN
External resources

Characterizations

NFATC2 (Homo sapiens)
GM12878K562HepG2liver
Method: immunoblot
Attachment from submitter
not compliant
Caption
a) Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order: GM12878, K562, HepG2, Liver using the antibody HPA024369.
Reviewer comment
Multiple bands with none making up >50% of the total signal. Expected size (~100kD) is missing from image and caption. May possibly be rescued with a siRNA knockdown
Submitted by
Trupti Kawli
Lab
Michael Snyder, Stanford
NFATC2 (Homo sapiens)
K562
Method: immunoprecipitation
Attachment from submitter
compliant
Caption
b) Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA024369 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG. Expected size ~100 kDa.
Submitted by
Trupti Kawli
Lab
Michael Snyder, Stanford