ENCAB000BOL
Antibody against Homo sapiens NFATC2
Homo sapiens
K562
partially characterized
Homo sapiens
GM12878, HepG2, liver
not characterized to standards
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA024369
- Lot ID
- R12517
- Characterized targets
- NFATC2 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- Nuclear factor of activated T-cells, cytoplasmic 2 recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- GSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTN
- External resources
Characterizations
NFATC2 (Homo sapiens)
GM12878K562HepG2liver
Method: immunoblot
not compliant
- Caption
- a) Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order: GM12878, K562, HepG2, Liver using the antibody HPA024369.
- Reviewer comment
- Multiple bands with none making up >50% of the total signal. Expected size (~100kD) is missing from image and caption. May possibly be rescued with a siRNA knockdown
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- NFATC2_HPA024369_WB_a.jpg
NFATC2 (Homo sapiens)
K562
Method: immunoprecipitation
compliant
- Caption
- b) Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA024369 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG. Expected size ~100 kDa.
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- NFATC2_HPA024369_WB_b.jpg