ENCAB000BNJ
Antibody against Homo sapiens STAT4
Homo sapiens
at least one cell type or tissue
not pursued
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA001860
- Lot ID
- R00593
- Characterized targets
- STAT4 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- Signal transducer and activator of transcription 4 recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- PMHVAVVISNCLREERRILAAANMPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQTMDQSDKNSAMVNQEVLTLQEMLNSLDFKRKEALSKMTQIIHETDL
- External resources
Characterizations
STAT4 (Homo sapiens)
Method: immunoblot
not submitted for review by lab
- Caption
- a) Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order: GM12878, K562, Hela S3, HepG2, IMR90, A549, Heart using the antibody HPA001860.
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- STAT4_HPA001860_WB_a.jpg
STAT4 (Homo sapiens)
Method: immunoprecipitation
not submitted for review by lab
- Caption
- b) Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA001860 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- STAT4_HPA001860_WB_b.jpg