ENCAB000BMS
Antibody against Homo sapiens CTBP1
Homo sapiens
K562, GM12878, liver
partially characterized
Homo sapiens
HepG2, HeLa-S3, MCF-7
not characterized to standards
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA018987
- Lot ID
- R07836
- Characterized targets
- CTBP1 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- C-terminal-binding protein 1 recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- YPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL
- External resources
Characterizations
CTBP1 (Homo sapiens)
GM12878K562HepG2HeLa-S3MCF-7liver
Method: immunoblot
compliant
- Caption
- Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order : GM12878, K562, HepG2, HelaS3, MCF7 and Liver using the antibody HPA018987. Molecular mass: 47535 Da
- Reviewer comment
- Band is not 50% of overall signal (Lanes 2, 3, 4, 5). Lanes 1 and 6 are compliant.
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- CTBP1_HPA018987_WB_a.jpg
CTBP1 (Homo sapiens)
K562
Method: immunoprecipitation
compliant
- Caption
- b) Immunoprecipitation was performed on nuclear extracts from the cell line: k562, using the antibody HPA018987 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG. Expected size is 46-48 kDa.
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- CTBP1_HPA018987_WB_b.jpg