ENCAB000BMI
Antibody against Homo sapiens ID2
Homo sapiens
at least one cell type or tissue
not pursued
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA027612
- Lot ID
- R28171
- Characterized targets
- ID2 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- Inhibitor of DNA binding 2, dominant negative helix-loop-helix protein recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- MEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
- External resources
Characterizations
ID2 (Homo sapiens)
Method: immunoblot
not submitted for review by lab
- Caption
- a) Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order: GM12878, K562, Hela S3, HepG2, IMR90, A549, Heart using the antibody HPA027612.
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- ID2_HPA027612_WB_a.jpg
ID2 (Homo sapiens)
Method: immunoprecipitation
not submitted for review by lab
- Caption
- b) Immunoprecipitation was performed on nuclear extracts from the cell line: HelaS3, using the antibody HPA027612 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- ID2_HPA027612_WB_b.jpg