ENCAB000BMD
Antibody against Homo sapiens FOXP1
Homo sapiens
K562, HepG2
characterized to standards with exemption
Homo sapiens
GM12878, HeLa-S3, MCF-7, liver
not characterized to standards
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA003876
- Lot ID
- A27581
- Characterized targets
- FOXP1 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- Forkhead box protein P1 recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- QMQQLQQQHLLSLQRQGLLTIQPGQPALPLQPLAQGMIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNPHASTNGQLSVHTPKRESLSHEEHPHSHPLYGHGVCKWPGCEAVCEDFQSFLKHLNS
- External resources
Characterizations
FOXP1 (Homo sapiens)
exempt from standards
- Caption
- IP followed by mass spectrometry. Briefly, protein was immunoprecipitated from K562 nuclear cell lysates using the antibody HPA003876, and the IP fraction was loaded on a 10% polyacrylamide gel (NuPAGEBis-Tris Gel) and separated with an Invitrogen NuPAGE electrophoresis system. The gel was stained by ColloidialCoomassie G-250 stain, gel fragments corresponding to the bands indicated were excised. Then proteins were trypsinized using the in-gel digestion method. Digested proteins were analyzed on an Orbitrap Elite mass spectrometer (Thermo Scientific) by the nanoLC-ESI-MS/MS technique. Peptides were identified by the SEQUEST algorithm and filtered with a high confidence threshold (Peptide false discovery rate < 1%, 2 unique peptides per protein minimum, mass error < 10 ppm).
- Submitter comment
- FUS, DDX5, G3BP1, ILF3, DDX3X and TAF15 are not DNA binding TFs. FOXP4 has interaction with FOXP1, http://thebiogrid.org/117989/summary/homo-sapiens/foxp1.html.
- Reviewer comment
- The ENCODE Antibody Review panel decided to exempt this characterization on 12/19/16, agreeing with the submitters that the proteins ranked about FOXP1 are not sequence-specific TFs.
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- FOXP1_(HPA0030876)_final.pdf
FOXP1 (Homo sapiens)
GM12878K562HepG2HeLa-S3MCF-7liver
not compliant
- Caption
- Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order : GM12878, K562, HepG2, HelaS3, MCF7 and Liver using the antibody HPA003876. Molecular mass: 75317 Da
- Reviewer comment
- Band is either missing or is not 50% of signal
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- FOXP1_HPA003876_WB_a.jpg
FOXP1 (Homo sapiens)
HepG2
exempt from standards
- Caption
- b) Immunoprecipitation was performed on nuclear extracts from the cell line: HepG2, using the antibody HPA003876 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG. Expecyed size ~75 kDa.
- Submitter comment
- FOXP1 has 8 isoforms, including 75KD, 65KD and 54KD, it may explain the multiple bands.
- Reviewer comment
- Multiple bands and marked band is not 50% of total signal
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- FOXP1_HPA003876_WB_b.jpg
FOXP1 (Homo sapiens)
K562
compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line K562 using the antibody HPA003876. Lane 1: input nuclear lysate. Lane 2: material immunoprecipitated with antibody. Lane 3: material immunoprecipitated using control IgG. Marked bands were excised from gel and subjected to analysis by mass spectrometry. Target molecular weight: 75.3.
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- K562-FOXP1 (HPA003876).JPG