ENCAB000BMB
Alternate accession: ENCAB551CQT
Antibody against Homo sapiens NBN
Homo sapiens
HepG2
characterized to standards
Homo sapiens
GM12878, K562, HeLa-S3, MCF-7, liver
not characterized to standards
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA001429
- Lot ID
- R07264
- Characterized targets
- NBN (Homo sapiens)
- Lot ID aliases
- A97300
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- Nibrin recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- DTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDL
- Aliases
- michael-snyder:AS-1127
- External resources
Characterizations
NBN (Homo sapiens)
HepG2
compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line HepG2 using the antibody HPA001429_(ENCAB000BMB). Lane 1: input nuclear lysate. Lane 2: material immunoprecipitated with antibody. Lane 3: material immunoprecipitated using control IgG. Marked bands were excised from gel and subjected to analysis by mass spectrometry. Target molecular weight: 85.0.
- Reviewer comment
- Multiple immunoreactive bands but mass spec shows target TF in both marked regions.
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- MS1044_5_NBN-HPA001429.JPG
NBN (Homo sapiens)
compliant
- Caption
- IP followed by mass spectrometry. Briefly, protein was immunoprecipitated from HepG2 nuclear cell lysates using the antibody HPA001429_(ENCAB000BMB), and the IP fraction was loaded on a 10% polyacrylamide gel (NuPAGEBis-Tris Gel) and separated with an Invitrogen NuPAGE electrophoresis system. The gel was stained by ColloidialCoomassie G-250 stain, gel fragments corresponding to the bands indicated were excised. Then proteins were trypsinized using the in-gel digestion method. Digested proteins were analyzed on an Orbitrap Elite mass spectrometer (Thermo Scientific) by the nanoLC-ESI-MS/MS technique. Peptides were identified by the SEQUEST algorithm and filtered with a high confidence threshold (Peptide false discovery rate < 1%, 2 unique peptides per protein minimum, mass error < 10 ppm).
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- NBN_HPA001429 final.pdf
NBN (Homo sapiens)
GM12878K562HepG2HeLa-S3MCF-7liver
not compliant
- Caption
- Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order : GM12878, K562, HepG2, HelaS3, MCF7 and Liver using the antibody HPA001429. Molecular mass: 84959 Da
- Reviewer comment
- Band is not 50% of overall signal
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- NBN_HPA001429_WB_a.jpg
NBN (Homo sapiens)
HepG2
not compliant
- Caption
- b) Immunoprecipitation was performed on nuclear extracts from the cell line: HepG2, using the antibody HPA001429 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG. Expected size ~85 kDa.
- Reviewer comment
- Band is not 50% of total signal
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- NBN_HPA001429_WB_b.jpg