ENCAB962CNL
Antibody against Homo sapiens MEIS2
Homo sapiens
K562
partially characterized
Homo sapiens
at least one cell type or tissue
not pursued
Homo sapiens
MCF-7, HEK293T
not characterized to standards
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA003256
- Lot ID
- R89735
- Characterized targets
- MEIS2 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- Homeobox protein Meis2 recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- LEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSV
- Aliases
- michael-snyder:763
- External resources
Characterizations
MEIS2 (Homo sapiens)
K562
Method: immunoprecipitation
compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA003256. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
MEIS2 (Homo sapiens)
Method: immunoprecipitation
not submitted for review by lab
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: GM12878, using the antibody HPA003256. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 51.790
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
MEIS2 (Homo sapiens)
Method: immunoprecipitation
not submitted for review by lab
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: HepG2, using the antibody HPA003256. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 51.790
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
MEIS2 (Homo sapiens)
MCF-7
Method: immunoprecipitation
not compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: MCF-7, using the antibody HPA003256. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
- Reviewer comment
- Marked band is also in the IgG lane
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- expt1066-1-MEIS2-HPA003256.jpg
MEIS2 (Homo sapiens)
HEK293T
Method: immunoprecipitation
not compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: HEK293T, using the antibody HPA003256. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 51.790
- Reviewer comment
- KCO: IgG has same banding as IP (cannot tell difference between actual antibody-protein interaction to heavy chain of antibody)
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- Expt1123_3-MEIS2-HPA003256.JPG