ENCAB962CNL

Antibody against Homo sapiens MEIS2

Homo sapiens
K562
partially characterized
Homo sapiens
at least one cell type or tissue
not pursued
Homo sapiens
HEK293T, MCF-7
not characterized to standards
Status
released
Source (vendor)
Sigma
Product ID
HPA003256
Lot ID
R89735
Characterized targets
MEIS2 (Homo sapiens)
Host
rabbit
Clonality
polyclonal
Purification
affinity
Isotype
IgG
Antigen description
Homeobox protein Meis2 recombinant protein epitope signature tag (PrEST)
Antigen sequence
LEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSV
Aliases
michael-snyder:763
External resources

Characterizations

MEIS2 (Homo sapiens)
K562
Method: immunoprecipitation
Attachment from submitter
compliant
Caption
Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA003256. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
Submitted by
Denis Salins
Lab
Michael Snyder, Stanford
MEIS2 (Homo sapiens)
Method: immunoprecipitation
Attachment from submitter
Caption
Immunoprecipitation was performed on nuclear extracts from the cell line: GM12878, using the antibody HPA003256. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 51.790
Submitted by
Denis Salins
Lab
Michael Snyder, Stanford
MEIS2 (Homo sapiens)
Method: immunoprecipitation
Attachment from submitter
Caption
Immunoprecipitation was performed on nuclear extracts from the cell line: HepG2, using the antibody HPA003256. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 51.790
Submitted by
Denis Salins
Lab
Michael Snyder, Stanford
MEIS2 (Homo sapiens)
MCF-7
Method: immunoprecipitation
Attachment from submitter
not compliant
Caption
Immunoprecipitation was performed on nuclear extracts from the cell line: MCF-7, using the antibody HPA003256. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
Reviewer comment
Marked band is also in the IgG lane
Submitted by
Denis Salins
Lab
Michael Snyder, Stanford
MEIS2 (Homo sapiens)
HEK293T
Method: immunoprecipitation
Attachment from submitter
not compliant
Caption
Immunoprecipitation was performed on nuclear extracts from the cell line: HEK293T, using the antibody HPA003256. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 51.790
Reviewer comment
KCO: IgG has same banding as IP (cannot tell difference between actual antibody-protein interaction to heavy chain of antibody)
Submitted by
Nathaniel Watson
Lab
Michael Snyder, Stanford