ENCAB946WHJ
Antibody against Caenorhabditis elegans rpc-1
Caenorhabditis elegans
any cell type or tissue
awaiting characterization
- Status
- released
- Source (vendor)
- SDIX, LLC
- Product ID
- SDQ4663
- Lot ID
- unknown
- Characterized targets
- rpc-1 (Caenorhabditis elegans)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Antigen description
- RPC-1 is the largest and specific subunit of RNA polymerase III. SDQ4663 antibody in ChIP-seq and ChIP-chip analyses produced strong binding peaks almost exclusively at annotated Pol III-transcribed genes. These genes include tRNA genes and snoRNA genes as expected (Li et al., 2008). Motif analysis confirmed that these genes possess BoxA/B motifs that are reported recognition elements of the Pol III machinery (Li et al., 2008). As evidenced from biochemical studies, RPC-1 peaks occur between TFIIIB and TFIIIC binding sites within regulatory regions (Schramm and Hernandez, 2002). We believe that these evidences are sufficient to support the specificity of this RPC-1 antibody. In vivo analysis of Caenorhabditis elegans noncoding RNA promoter motifs. Li T, He H, Wang Y, Zheng H, Skogerbo G, Chen R. BMC Mol Biol. 2008 Aug 5;9:71. Recruitment of RNA polymerase III to its target promoters. Schramm L, Hernandez N. Genes Dev. 2002 Oct 15;16(20):2593-620.
- Antigen sequence
- DRRHVMLLADVMTYRGEVLGITRNGLVKMKDSVLLLASFEKTMDHLFEAAFFSQRDVIHGVSECIIMGTPMTVGTGTFKLMQKYDKKAVLKQNSPIFERL
- Aliases
- valerie-reinke:SDQ4663