ENCAB579FDC

Antibody against Caenorhabditis elegans dpl-1

Caenorhabditis elegans
at least one cell type or tissue
awaiting characterization
Status
released
Source (vendor)
SDIX, LLC
Product ID
4495.00.02
Lot ID
G3048-109
Host
rabbit
Clonality
polyclonal
Purification
affinity
Antigen description
An affinity purified rabbit polyclonal antibody to DPL-1 obtained from SDI. This is an In vivo generated recominant protein fragment targeted to C. elegans.
Antigen sequence
INTDKEANVECSVSSDKSEFLFSFDKKFEIHDDFEILKKLNLACSLETTNPTAEEVKTAKSFLPTLHQHYVDEIIANRKKVEAEKEEKRKQQQLIADQMS
External resources

Characterizations

dpl-1 (Caenorhabditis elegans)
Method: knockdown or knockout
Attachment from submitter
not reviewed
Submitted by
Susan Strome
Lab
Susan Strome, UCSC
dpl-1 (Caenorhabditis elegans)
Method: immunoblot
Attachment from submitter
not reviewed
Submitted by
Susan Strome
Lab
Susan Strome, UCSC