ENCAB579FDC
Antibody against Caenorhabditis elegans dpl-1
Caenorhabditis elegans
at least one cell type or tissue
awaiting characterization
- Status
- released
- Source (vendor)
- SDIX, LLC
- Product ID
- 4495.00.02
- Lot ID
- G3048-109
- Characterized targets
- dpl-1 (Caenorhabditis elegans)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Antigen description
- An affinity purified rabbit polyclonal antibody to DPL-1 obtained from SDI. This is an In vivo generated recominant protein fragment targeted to C. elegans.
- Antigen sequence
- INTDKEANVECSVSSDKSEFLFSFDKKFEIHDDFEILKKLNLACSLETTNPTAEEVKTAKSFLPTLHQHYVDEIIANRKKVEAEKEEKRKQQQLIADQMS
- External resources
Characterizations
dpl-1 (Caenorhabditis elegans)
Method: knockdown or knockout
not reviewed
- Submitted by
- Susan Strome
- Lab
- Susan Strome, UCSC
- Grant
- U01HG004270
- Download
- SDQ3599_DPL1.jpg
dpl-1 (Caenorhabditis elegans)
Method: immunoblot
not reviewed
- Submitted by
- Susan Strome
- Lab
- Susan Strome, UCSC
- Grant
- U01HG004270
- Download
- SDQ3599_DPL1.jpg