ENCAB564AON
Antibody against Caenorhabditis elegans efl-1
Caenorhabditis elegans
any cell type or tissue
awaiting characterization
- Status
- released
- Source (vendor)
- Novus
- Product ID
- 44960002
- Lot ID
- G3048-110A01
- Characterized targets
- efl-1 (Caenorhabditis elegans)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Antigen description
- This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. This antibody is available from different lot and animal productions. These anti-C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg. Lot # G3048-110A01 Animal number SDQ3590
- Antigen sequence
- MEDSYNDMEDPGFRQLSDMELQKALEMTKQSSIKNNLMLGLDNELDFDFDFDEDEDLDQPQMGTRADKSLGLLAKRFIRMIQYSPYGRCD LNTAAEALNV
- External resources