ENCAB421OSQ
Antibody against Homo sapiens MEF2B
Homo sapiens
GM12878
partially characterized
Homo sapiens
HepG2
not pursued
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA004734
- Lot ID
- R57933
- Characterized targets
- MEF2B (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- myocyte enhancer factor 2B recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- VLLKYTEYSEPHESRTNTDILETLKRRGIGLDGPELEPDEGPEEPGEKFRRLAGEGGDPALPRPRLYPAAPAMPSPDVVYGALPPPGCDPSGLGEALPAQSRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTE
- Aliases
- michael-snyder:718
- External resources
Characterizations
MEF2B (Homo sapiens)
GM12878
compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: GM12878, using the antibody HPA004734. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
MEF2B (Homo sapiens)
HepG2
not submitted for review by lab
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line HepG2 using the antibody HPA004734. Lane 1: input nuclear lysate. Lane 2: material immunoprecipitated with antibody. Lane 3: material immunoprecipitated using control IgG. Marked bands were excised from gel and subjected to analysis by mass spectrometry. Target molecular weight: 38.639.
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- MEF2B_HPA004734.jpg