ENCAB336DFB
Antibody against Homo sapiens CREB3L1
Homo sapiens
K562, GM12878
characterized to standards
Homo sapiens
any cell type or tissue
partially characterized
Homo sapiens
HEK293T
not characterized to standards
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA024069
- Lot ID
- R11037
- Characterized targets
- CREB3L1 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- cAMP-responsive element-binding protein 3-like protein 1 recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- LNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALGHKLCSIMVKQE
- Aliases
- michael-snyder:750
- External resources
Characterizations
CREB3L1 (Homo sapiens)
GM12878
compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: GM12878 using the antibody HPA024069. The image shows western blot analysis of input, flowthrough, immunoprecipitate, and mock immunoprecipitate using IgG. Target molecular weight: 57.005.
- Reviewer comment
- This is detected as a thicker band
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
CREB3L1 (Homo sapiens)
not submitted for review by lab
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: MCF-7, using the antibody HPA024069. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 57.005
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
CREB3L1 (Homo sapiens)
K562
compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA024069. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
- Reviewer comment
- Hard to tell given how close it is to the heavy chain but right sized band appears in the input and the band in the IP has a higher signal relative to the IgG around the expected size.
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
CREB3L1 (Homo sapiens)
compliant
- Caption
- The motif for target CREB3L1 is represented by the attached position weight matrix (PWM) derived from ENCFF867IEZ. Motif enrichment analysis was done by Dr. Zhizhuo Zhang (Broad Institute, Kellis Lab). Accept probability score: 0.600848823198!; Global enrichment Z-score: 3.187457175; Positional bias Z-score: 4.982883907; Peak rank bias Z-score: 7.175607979; Enrichment rank: 1.0.
- Reviewer comment
- The agreed upon cut off is .6 percent accept probability.
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
CREB3L1 (Homo sapiens)
not submitted for review by lab
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: GM12878, using the antibody HPA024069. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 57.005
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- expt1035_0001.jpg
CREB3L1 (Homo sapiens)
HEK293T
not compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: HEK293T, using the antibody HPA024069. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 57.005
- Reviewer comment
- KCO: IgG has same banding as IP (cannot tell difference between actual antibody-protein interaction to heavy chain of antibody)
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- Expt1124_5-CREB3L1-HPA024069.JPG