ENCAB260QVN

Antibody against Homo sapiens HES2

Homo sapiens
any cell type or tissue
awaiting characterization
Status
released
Source (vendor)
Santa Cruz Biotech
Product ID
sc-166705
Lot ID
L0709
Characterized targets
HES2 (Homo sapiens)
Host
mouse
Clonality
monoclonal
Isotype
IgG1
Antigen description
HES2 Antibody (A-4) is a mouse monoclonal IgG1 (kappa light chain) raised against amino acids 64-173 mapping at the C-terminus of HES2 of human origin.
Antigen sequence
VRFLQELPASSWPTAAPLPCDSYREGYSACVARLARVLPACRVLEPAVSARLLEHLWRRAASATLDGGRAGDSSGPSAPAPAPASAPEPASAPVPSPPSPPCGPGLWRPW
Aliases
tim-reddy:L0709
External resources