ENCAB214VQJ
Antibody against Caenorhabditis elegans lem-2
Caenorhabditis elegans
at least one cell type or tissue
awaiting characterization
- Status
- released
- Source (vendor)
- SDIX, LLC
- Product ID
- 4854.00.02
- Lot ID
- unknown
- Characterized targets
- lem-2 (Caenorhabditis elegans)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Antigen description
- Rabbit antisera against the amino-terminal 100 amino acids of LEM-2 produced at SDI. 2.1M long oligo probes in a single array to cover the whole genome of C elegans
- Antigen sequence
- MVDVEKMSDAELRAELNVRGANVGPVTGTTRSLYEKKLKKLLSGGAKTPARPTVAKPAPKPTPKSAPAPKSPKSPPARRSIPRAAATAANSTINSTFNRS
- External resources
Characterizations
lem-2 (Caenorhabditis elegans)
Method: knockdown or knockout
not reviewed
- Submitted by
- Jason Lieb
- Lab
- Jason Lieb, UNC
- Grant
- U01HG004270
lem-2 (Caenorhabditis elegans)
Method: immunoblot
not reviewed
- Submitted by
- Jason Lieb
- Lab
- Jason Lieb, UNC
- Grant
- U01HG004270