ENCAB107TAJ
Antibody against Homo sapiens KLF5
Homo sapiens
MCF-7, GM12878
partially characterized
Homo sapiens
at least one cell type or tissue
not pursued
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA040398
- Lot ID
- R89656
- Characterized targets
- KLF5 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- Kruppel-like factor 5 (intestinal) recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- TYTMPSQFLPQQATYFPPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVNSQNIQPVRYNRRSNPDLEKRRIHYCDYPGCTK
- Aliases
- michael-snyder:757
- External resources
Characterizations
KLF5 (Homo sapiens)
MCF-7
Method: immunoprecipitation
compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: MCF-7, using the antibody HPA040398. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Expected Molecular Weight: 51 KD
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
KLF5 (Homo sapiens)
GM12878
Method: immunoprecipitation
compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: GM12878, using the antibody HPA040398. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
- Reviewer comment
- The lanes should be clearly labeled as well as the major band but will give benefit of the doubt.
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- Expt 804_3 KLF5.jpg
KLF5 (Homo sapiens)
Method: immunoprecipitation
not submitted for review by lab
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA040398. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 50.792
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- Expt1111_4-KLF5-HPA040398_K562.JPG
KLF5 (Homo sapiens)
Method: immunoprecipitation
not submitted for review by lab
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: HepG2, using the antibody HPA040398. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 50.792
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- Expt1111_5-KLF5-HPA040398_HepG2.JPG
KLF5 (Homo sapiens)
Method: immunoprecipitation
not submitted for review by lab
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: HEK293T, using the antibody HPA040398. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 50.792
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996