ENCAB098HYL

Antibody against Caenorhabditis elegans zfp-1

Caenorhabditis elegans
at least one cell type or tissue
awaiting characterization
Status
released
Source (vendor)
SDIX, LLC
Product ID
4514.00.02
Lot ID
unknown
Host
rabbit
Clonality
polyclonal
Purification
affinity
Antigen description
An affinity purified rabbit polyclonal antibody to ZFP-1 obtained from Strategic Diagnostics Inc. (SDI). Raised against amino acids 46-145 of WP:CE25003. 2.1M long oligo probes in a single array to cover the whole genome of C elegans.
Antigen sequence
EGEWFCAKCTKASAMMPGSINEATFCCQLCPFDYGALKKTDRNGWAHVICALYIPEVRFGNVHSMEPVILNDVPTDKFNKLCYICNEERPNDAKKGACMS
External resources

Characterizations

zfp-1 (Caenorhabditis elegans)
Method: knockdown or knockout
Attachment from submitter
not reviewed
Submitted by
Susan Strome
Lab
Susan Strome, UCSC
zfp-1 (Caenorhabditis elegans)
Method: immunoblot
Attachment from submitter
not reviewed
Submitted by
Susan Strome
Lab
Susan Strome, UCSC