ENCAB098HYL
Antibody against Caenorhabditis elegans zfp-1
Caenorhabditis elegans
at least one cell type or tissue
awaiting characterization
- Status
- released
- Source (vendor)
- SDIX, LLC
- Product ID
- 4514.00.02
- Lot ID
- unknown
- Characterized targets
- zfp-1 (Caenorhabditis elegans)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Antigen description
- An affinity purified rabbit polyclonal antibody to ZFP-1 obtained from Strategic Diagnostics Inc. (SDI). Raised against amino acids 46-145 of WP:CE25003. 2.1M long oligo probes in a single array to cover the whole genome of C elegans.
- Antigen sequence
- EGEWFCAKCTKASAMMPGSINEATFCCQLCPFDYGALKKTDRNGWAHVICALYIPEVRFGNVHSMEPVILNDVPTDKFNKLCYICNEERPNDAKKGACMS
- External resources
Characterizations
zfp-1 (Caenorhabditis elegans)
not reviewed
- Submitted by
- Susan Strome
- Lab
- Susan Strome, UCSC
- Grant
- U01HG004270
zfp-1 (Caenorhabditis elegans)
not reviewed
- Submitted by
- Susan Strome
- Lab
- Susan Strome, UCSC
- Grant
- U01HG004270