ENCAB096JPW
Antibody against Drosophila melanogaster cad
Drosophila melanogaster
any cell type or tissue
awaiting characterization
- Status
- released
- Source (vendor)
- John Reinitz
- Product ID
- non-commercial Top2 modENCODE antibody 1
- Lot ID
- unknown
- Characterized targets
- cad (Drosophila melanogaster)
- Host
- guineapig
- Clonality
- polyclonal
- Purification
- affinity
- Antigen description
- From John Reinitz Lab: As part of a long term project to model the segmentation cascade from maternal gradients to wingless/engrailed stripe formation, our lab is constructing a precise numerical atlas of blastoderm gene expression. In order to do this, we have raised a panel of antibodies to segmentation genes (D. Kosman;S. Small;and J. Reinitz: Rapid preparation of a panel of polyclonal antibodies to Drosophila segmentation proteins. Development Genes and Evolution, 208(5): 290-294, 1998) which we would like to make available to the fly community. Confocal images made with these sera and quantative data on gene expression in segmentation network can be found at FlyEx Database. These sera were raised by David Kosman. This work is supported by grant RO1-RR-07801 from the US NIH. We thank S. Small, H. Jackle, P. MacDonald, M. Frasch, L. Pick, P. Gergen, E. Ward, D. Coulter, K. Kadigan, and C. Desplan for sending us expression constructs!!!"
- Antigen sequence
- MVSHYYNTLPYTQKHSAANLAYASAAGQPWNWTPNYHHTPPNHQFLGDVD SSHAAHHAAAAHQMYYNSHHMFHSAAAASAGEWHSPASSTADNFVQNVPT SAHQLMQQHHHHHAHASSSSASSGSSSSGGAPGAPQLNETNSSIGVGGAG GGGGVGGATDGGPGSAPPNHQQHIAEGLPSPPITVSGSEISSPGAPTSAS SPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPSKP PYFDWMKKPAYPAQPQPGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITI RRKSELAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVGVQHADY SQLLDAKAKLEPGLHLSHSLAHSMNPMAAMNIPAMRLHPHLAAHSHSLAA VAAHSHQLQQQHSAQMSAAAAVGTLSM
- External resources