ENCAB060JJI
Antibody against Homo sapiens ZNF24
Homo sapiens
K562, HepG2, GM12878, MCF-7
characterized to standards
Homo sapiens
any cell type or tissue
partially characterized
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA024062
- Lot ID
- A71676
- Characterized targets
- ZNF24 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- Zinc finger protein 24 recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- LESELDDPGQPVSLRRRKREVLVEDMVSQEEAQGLPSSELDAVENQLKWASWELHSLRHCDDDGRTENGALAPKQELPSALESHEVPGTLSMGVPQIFKYGETCFPKGRFERKRNPSRKKQHICDECGKHFS
- Aliases
- michael-snyder:694
- External resources
Characterizations
ZNF24 (Homo sapiens)
GM12878
compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: GM12878, using the antibody HPA024062. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 42.155
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- 1064_7_ZNF24_HPA024062_GM12878.jpg
ZNF24 (Homo sapiens)
HepG2
compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: HepG2, using the antibody HPA024062. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 42.155
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- 1064_8_ZNF24_HPA024062_HepG2.jpg
ZNF24 (Homo sapiens)
MCF-7
compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: MCF-7, using the antibody HPA024062. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 42.155
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- 1064_9_ZNF24_HPA024062_MCF7.jpg
ZNF24 (Homo sapiens)
K562
compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA024062. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- 2_ZNF22.jpg
ZNF24 (Homo sapiens)
not submitted for review by lab
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: HEK293T, using the antibody HPA024062. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 42.155
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- Expt1119_4-ZNF24-HPA024062.JPG
ZNF24 (Homo sapiens)
K562
compliant
- Caption
- Immunoprecipitation of ZNF24 from K562 cells using HPA024062. Lane 1: input nuclear lysate. Lane 2: material immunoprecipitated with HPA024062. Lane 3: material immunoprecipitated using control IgG. Band A was excised from gel and subject to analysis by mass spectrometry. The expected band size is 42 kDa.
- Submitted by
- Kathrina Onate
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- ZNF24.jpeg
ZNF24 (Homo sapiens)
compliant
- Caption
- IP followed by mass spectrometry: Briefly, protein was immunoprecipitated from K562 nuclear cell lysates using HPA024062, and the IP fraction was loaded on a 10% polyacrylamide gel (NuPAGEBis-Tris Gel) and separated with an Invitrogen NuPAGE electrophoresis system. The gel was stained by ColloidialCoomassie G-250 stain, gel fragments corresponding to the bands indicated were excised. Then proteins were trypsinized using the in-gel digestion method. Digested proteins were analyzed on an Orbitrap Elite mass spectrometer (Thermo Scientific) by the nanoLC-ESI-MS/MS technique. Peptides were identified by the SEQUEST algorithm and filtered with a high confidence threshold (Peptide false discovery rate < 1%, 2 unique peptides per protein minimum, mass error < 10 ppm).
- Submitted by
- Kathrina Onate
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996