ENCAB000BOS

Antibody against Homo sapiens PAX8

Homo sapiens
HepG2, K562, MCF-7, GM12878
characterized to standards
Homo sapiens
any cell type or tissue
partially characterized
Homo sapiens
liver
not characterized to standards
Status
released
Source (vendor)
Sigma
Product ID
HPA030062
Lot ID
A82758
Characterized targets
PAX8 (Homo sapiens)
Host
rabbit
Clonality
polyclonal
Purification
affinity
Isotype
IgG
Antigen description
Paired box 8 recombinant protein epitope signature tag (PrEST)
Antigen sequence
QPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQ
External resources

Characterizations

PAX8 (Homo sapiens)
MCF-7
Method: immunoprecipitation
Attachment from submitter
compliant
Caption
Immunoprecipitation was performed on nuclear extracts from the cell line: MCF-7, using the antibody HPA030062. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 48.2
Submitted by
Denis Salins
Lab
Michael Snyder, Stanford
PAX8 (Homo sapiens)
Method: motif enrichment
compliant
Caption
The motif for target PAX8 is represented by the attached position weight matrix (PWM) derived from ENCFF455YHJ. Motif enrichment analysis was done by Dr. Zhizhuo Zhang (Broad Institute, Kellis Lab) using known motifs (http://compbio.mit.edu/encode-motifs/) and previously published ChIP-seq data (http://www.broadinstitute.org/~zzhang/motifpipeline/data/TrainSetInfo.txt). The accept probability score of the given transcription factor was calculated using a Bayesian approach. This analysis also includes three motif enrichment scores, computed by overlapping the motif instances with the given ChIP-seq peak locations, as well as an enrichment rank. For more information on the underlying statistical methods, please see the attached document. Accept probability score: 0.622305554931 Global enrichment Z-score: 8.99046771753 Positional bias Z-score: 5.62807996875 Peak rank bias Z-score: 6.27757558625 4 Enrichment rank: 1.0
Submitted by
Jessika Adrian
Lab
Michael Snyder, Stanford
PAX8 (Homo sapiens)
HepG2
Method: immunoprecipitation
Attachment from submitter
compliant
Caption
Immunoprecipitation was performed on nuclear extracts from the cell line: HepG2, using the antibody HPA030062. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 48.2
Submitted by
Denis Salins
Lab
Michael Snyder, Stanford
PAX8 (Homo sapiens)
Method: immunoprecipitation
Attachment from submitter
Caption
Immunoprecipitation was performed on nuclear extracts from the cell line: HEK293T, using the antibody HPA030062. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 48.2
Submitted by
Nathaniel Watson
Lab
Michael Snyder, Stanford
PAX8 (Homo sapiens)
GM12878
Method: immunoprecipitation
Attachment from submitter
compliant
Caption
Immunoprecipitation was performed on nuclear extracts from the cell line: GM12878, using the antibody HPA030062. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 48.2
Reviewer comment
Multiple bands and marked band is <50% of total signal in lane. Marked band also not seen in input lane.
Submitted by
Denis Salins
Lab
Michael Snyder, Stanford
Download
PAX8 (Homo sapiens)
GM12878K562HepG2liver
Method: immunoblot
Attachment from submitter
not compliant
Caption
a) Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order: GM12878, K562, HepG2, Liver using the antibody HPA030062. Molecular mass: 48218 Da
Reviewer comment
Multiple bands with none making up >50% of the total signal.
Submitted by
Trupti Kawli
Lab
Michael Snyder, Stanford
PAX8 (Homo sapiens)
K562
Method: immunoprecipitation
Attachment from submitter
compliant
Caption
b) Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA030062 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG. Expected size ~48 kDa.
Submitted by
Trupti Kawli
Lab
Michael Snyder, Stanford