ENCAB000BOG
Antibody against Homo sapiens SOX6
Homo sapiens
K562, HEK293T
characterized to standards
Homo sapiens
HepG2
characterized to standards with exemption
Homo sapiens
GM12878, liver, MCF-7
not characterized to standards
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA001923
- Lot ID
- A81784
- Characterized targets
- SOX6 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- Transcription factor SOX-6 recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- TYKPGDNYPVQFIPSTMAAAAASGLSPLQLQQLYAAQLASMQVSPGAKMPSTPQPPNTAGTVSPTGIKNEKRGTSPVTQVKDEAAAQPLNLSSRPKTAEPVKSPTS
- External resources
Characterizations
SOX6 (Homo sapiens)
HepG2
not compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: HepG2, using the antibody HPA001923. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 92.0
- Reviewer comment
- Band near 37kD size is more prominent than the one at the expected size.
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- 1093_10_SOX6_HPA001923.jpg
SOX6 (Homo sapiens)
MCF-7
not compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: MCF-7, using the antibody HPA001923. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
- Reviewer comment
- Multiple bands, marked band not >50% and would possibly need siRNA knockdown followup to be exempted
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- expt1032_3.jpg
SOX6 (Homo sapiens)
HEK293T
compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: HEK293T, using the antibody HPA001923. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 92.0
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- Expt1121_2-SOX6-HPA001923.JPG
SOX6 (Homo sapiens)
HepG2
exempt from standards
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line HepG2 using the antibody HPA001923. Lane 1: input nuclear lysate. Lane 2: material immunoprecipitated with antibody. Lane 3: material immunoprecipitated using control IgG. Marked bands were excised from gel and subjected to analysis by mass spectrometry. Target molecular weight: 92.0.
- Submitter comment
- We'll analyze all immunoreactive bands by mass-spec.
- Reviewer comment
- Multiple immunoreactive bands, with the major band not at the expected size. Subsequent IP-MS did reveal the target factor in the band around expected size (A) and a putative interactor in the major band (B)
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- MS1044_8_SOX6-HPA001923.JPG
SOX6 (Homo sapiens)
compliant
- Caption
- IP followed by mass spectrometry. Briefly, protein was immunoprecipitated from HepG2 nuclear cell lysates using the antibody HPA001923, and the IP fraction was loaded on a 10% polyacrylamide gel (NuPAGEBis-Tris Gel) and separated with an Invitrogen NuPAGE electrophoresis system. The gel was stained by ColloidialCoomassie G-250 stain, gel fragments corresponding to the bands indicated were excised. Then proteins were trypsinized using the in-gel digestion method. Digested proteins were analyzed on an Orbitrap Elite mass spectrometer (Thermo Scientific) by the nanoLC-ESI-MS/MS technique. Peptides were identified by the SEQUEST algorithm and filtered with a high confidence threshold (Peptide false discovery rate < 1%, 2 unique peptides per protein minimum, mass error < 10 ppm).
- Submitter comment
- SOX6 has been shown to interact with SOX5 (https://thebiogrid.org/120714/summary/homo-sapiens/sox6.html). The SOX5 protein appears to have different isoforms, some of which are 86 and 41 kDa. In the higher band A, both proteins are ranked with the the same peptide count. In the lower band B, only SOX5 was detected. No other sequence specific TFs were ranked equally or above SOX6/SOX5 in band A and B. No sequence specific TF was detected in band C.
- Reviewer comment
- SOX6 is the highest ranked TF detected in band A but was not detected in bands B or C. SOX5 is detected in band B and the submitting lab has referenced an interaction between SOX5 and SOX6 by AP-MS in the published literature.
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- SOX6_HPA001923 final.pdf
SOX6 (Homo sapiens)
GM12878K562HepG2liver
not compliant
- Caption
- a) Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order: GM12878, K562, HepG2, Liver using the antibody HPA001923.
- Reviewer comment
- Multiple bands and most prominent band not that of expected size (~97kD - also not indicated on blot or caption).
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- SOX6_HPA001923_WB_a.jpg
SOX6 (Homo sapiens)
K562
compliant
- Caption
- b) Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA001923 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- SOX6_HPA001923_WB_b.jpg