ENCAB000BOD

Antibody against Homo sapiens RNF113A

Homo sapiens
K562, liver
partially characterized
Homo sapiens
HepG2, GM12878
not characterized to standards
Status
released
Source (vendor)
Sigma
Product ID
HPA000160
Lot ID
A05246
Characterized targets
RNF113A (Homo sapiens)
Host
rabbit
Clonality
polyclonal
Purification
affinity
Isotype
IgG
Antigen description
RING finger protein 113A recombinant protein epitope signature tag (PrEST)
Antigen sequence
GSSSDEGCTVVRPEKKRVTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVYKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSQKIQEELRGKEDDKIYR
External resources

Characterizations

RNF113A (Homo sapiens)
GM12878K562HepG2liver
Method: immunoblot
Attachment from submitter
compliant
Caption
a) Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order: GM12878, K562, HepG2, Liver using the antibody HPA000160.
Reviewer comment
Multiple bands, none >50 of total signal in lane. Expected size (~38.8kD) not indicated.
Submitted by
Trupti Kawli
Lab
Michael Snyder, Stanford
RNF113A (Homo sapiens)
K562
Method: immunoprecipitation
Attachment from submitter
compliant
Caption
b) Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA000160 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG. Expected size is ~38.8 kD.
Reviewer comment
A little higher than expected size (~38.8kD)
Submitted by
Trupti Kawli
Lab
Michael Snyder, Stanford