ENCAB000BOD
Antibody against Homo sapiens RNF113A
Homo sapiens
K562, liver
partially characterized
Homo sapiens
GM12878, HepG2
not characterized to standards
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA000160
- Lot ID
- A05246
- Characterized targets
- RNF113A (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- RING finger protein 113A recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- GSSSDEGCTVVRPEKKRVTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVYKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSQKIQEELRGKEDDKIYR
- External resources
Characterizations
RNF113A (Homo sapiens)
GM12878K562HepG2liver
compliant
- Caption
- a) Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order: GM12878, K562, HepG2, Liver using the antibody HPA000160.
- Reviewer comment
- Multiple bands, none >50 of total signal in lane. Expected size (~38.8kD) not indicated.
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- RNF113A_HPA000160_WB_a.jpg
RNF113A (Homo sapiens)
K562
compliant
- Caption
- b) Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA000160 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG. Expected size is ~38.8 kD.
- Reviewer comment
- A little higher than expected size (~38.8kD)
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- RNF113A_HPA000160_WB_b.jpg