ENCAB000BNU
Antibody against Homo sapiens ZNF207
Homo sapiens
K562
characterized to standards
Homo sapiens
GM12878, HepG2, MCF-7
characterized to standards with exemption
Homo sapiens
any cell type or tissue
partially characterized
Homo sapiens
HeLa-S3, liver
not characterized to standards
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA017013
- Lot ID
- A82699
- Characterized targets
- ZNF207 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- Zinc finger protein 207 recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- KPATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGP
- External resources
Characterizations
ZNF207 (Homo sapiens)
MCF-7
exempt from standards
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: MCF-7, using the antibody HPA017013. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
- Submitter comment
- ZNF207 has four isoforms. Isoform 1,2 and 4 (Uniprot: [O43670-1]; [O43670-2]; [O43670-4]) mass in around 50-52kDa. Isoform 3 (Uniprot: [O43670-3]) is 41kDa.
- Reviewer comment
- Doublet seen around expected size.
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- 3.jpg
ZNF207 (Homo sapiens)
HepG2
exempt from standards
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: HepG2, using the antibody HPA017013. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
- Submitter comment
- ZNF207 has four isoforms. Isoform 1,2 and 4 (Uniprot: [O43670-1]; [O43670-2]; [O43670-4]) mass in around 50-52kDa. Isoform 3 (Uniprot: [O43670-3]) is 41kDa.
- Reviewer comment
- Doublet seen around expected size.
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- 4.jpg
ZNF207 (Homo sapiens)
K562
exempt from standards
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA017013. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
- Submitter comment
- ZNF207 has four isoforms. Isoform 1,2 and 4 (Uniprot: [O43670-1]; [O43670-2]; [O43670-4]) mass in around 50-52kDa. Isoform 3 (Uniprot: [O43670-3]) is 41kDa.
- Reviewer comment
- Doublet seen around expected size.
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- expt1037_5.jpg
ZNF207 (Homo sapiens)
GM12878
exempt from standards
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: GM12878, using the antibody HPA017013. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
- Submitter comment
- ZNF207 has four isoforms. Isoform 1,2 and 4 (Uniprot: [O43670-1]; [O43670-2]; [O43670-4]) mass in around 50-52kDa. Isoform 3 (Uniprot: [O43670-3]) is 41kDa.
- Reviewer comment
- Doublet seen around expected size.
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- expt1065_1-ZNF207-HPA017013.jpg
ZNF207 (Homo sapiens)
not submitted for review by lab
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: HEK293T, using the antibody HPA017013. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 50.8
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- Expt1119_3-ZNF207-HPA017013 (2).JPG
ZNF207 (Homo sapiens)
compliant
- Caption
- IP followed by mass spectrometry. Briefly, protein was immunoprecipitated from K562 nuclear cell lysates using the antibody HPA017013, and the IP fraction was loaded on a 10% polyacrylamide gel (NuPAGEBis-Tris Gel) and separated with an Invitrogen NuPAGE electrophoresis system. The gel was stained by ColloidialCoomassie G-250 stain, gel fragments corresponding to the bands indicated were excised. Then proteins were trypsinized using the in-gel digestion method. Digested proteins were analyzed on an Orbitrap Elite mass spectrometer (Thermo Scientific) by the nanoLC-ESI-MS/MS technique. Peptides were identified by the SEQUEST algorithm and filtered with a high confidence threshold (Peptide false discovery rate < 1%, 2 unique peptides per protein minimum, mass error < 10 ppm).
- Submitter comment
- TUBB isn't a DNA-binding protein. http://www.uniprot.org/uniprot/Q5ST81
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- ZNF207_HPA017013 final.pdf
ZNF207 (Homo sapiens)
K562
compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line K562 using the antibody HPA017013. Lane 1: input nuclear lysate. Lane 2: material immunoprecipitated with antibody. Lane 3: material immunoprecipitated using control IgG. Marked bands were excised from gel and subjected to analysis by mass spectrometry. Target molecular weight: 50.8.
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- ZNF207_HPA017013.jpg
ZNF207 (Homo sapiens)
GM12878K562HepG2HeLa-S3MCF-7liver
exempt from standards
- Caption
- Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order : GM12878, K562, HepG2, HelaS3, MCF7 and Liver using the antibody HPA017013. Molecular mass: 50751 Da
- Submitter comment
- ZNF207 has four isoforms. Isoform 1,2 and 4 (Uniprot: [O43670-1]; [O43670-2]; [O43670-4]) mass in around 50-52kDa. Isoform 3 (Uniprot: [O43670-3]) is 41kDa.
- Reviewer comment
- Multiple strong immunoreactive bands seen in all analyzed cell types. Doublet seen in GM12878 is consistent with banding pattern in IPs.
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- ZNF207_HPA017013_WB_a.jpg
ZNF207 (Homo sapiens)
GM12878
exempt from standards
- Caption
- b) Immunoprecipitation was performed on nuclear extracts from the cell line: GM12878, using the antibody HPA017013 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG. Expected size ~50 kDa.
- Submitter comment
- ZNF207 has four isoforms. Isoform 1,2 and 4 (Uniprot: [O43670-1]; [O43670-2]; [O43670-4]) mass in around 50-52kDa. Isoform 3 (Uniprot: [O43670-3]) is 41kDa.
- Reviewer comment
- Doublet seen around expected size.
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- ZNF207_HPA017013_WB_b.jpg