ENCAB000BNU

Antibody against Homo sapiens ZNF207

Homo sapiens
K562
characterized to standards
Homo sapiens
MCF-7, HepG2, GM12878
characterized to standards with exemption
Homo sapiens
any cell type or tissue
partially characterized
Homo sapiens
HeLa-S3, liver
not characterized to standards
Status
released
Source (vendor)
Sigma
Product ID
HPA017013
Lot ID
A82699
Characterized targets
ZNF207 (Homo sapiens)
Host
rabbit
Clonality
polyclonal
Purification
affinity
Isotype
IgG
Antigen description
Zinc finger protein 207 recombinant protein epitope signature tag (PrEST)
Antigen sequence
KPATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGP
External resources

Characterizations

ZNF207 (Homo sapiens)
MCF-7
Method: immunoprecipitation
Attachment from submitter
exempt from standards
Caption
Immunoprecipitation was performed on nuclear extracts from the cell line: MCF-7, using the antibody HPA017013. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
Submitter comment
ZNF207 has four isoforms. Isoform 1,2 and 4 (Uniprot: [O43670-1]; [O43670-2]; [O43670-4]) mass in around 50-52kDa. Isoform 3 (Uniprot: [O43670-3]) is 41kDa.
Reviewer comment
Doublet seen around expected size.
Submitted by
Denis Salins
Lab
Michael Snyder, Stanford
Download
ZNF207 (Homo sapiens)
HepG2
Method: immunoprecipitation
Attachment from submitter
exempt from standards
Caption
Immunoprecipitation was performed on nuclear extracts from the cell line: HepG2, using the antibody HPA017013. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
Submitter comment
ZNF207 has four isoforms. Isoform 1,2 and 4 (Uniprot: [O43670-1]; [O43670-2]; [O43670-4]) mass in around 50-52kDa. Isoform 3 (Uniprot: [O43670-3]) is 41kDa.
Reviewer comment
Doublet seen around expected size.
Submitted by
Denis Salins
Lab
Michael Snyder, Stanford
Download
ZNF207 (Homo sapiens)
K562
Method: immunoprecipitation
Attachment from submitter
exempt from standards
Caption
Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA017013. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
Submitter comment
ZNF207 has four isoforms. Isoform 1,2 and 4 (Uniprot: [O43670-1]; [O43670-2]; [O43670-4]) mass in around 50-52kDa. Isoform 3 (Uniprot: [O43670-3]) is 41kDa.
Reviewer comment
Doublet seen around expected size.
Submitted by
Denis Salins
Lab
Michael Snyder, Stanford
Download
ZNF207 (Homo sapiens)
GM12878
Method: immunoprecipitation
Attachment from submitter
exempt from standards
Caption
Immunoprecipitation was performed on nuclear extracts from the cell line: GM12878, using the antibody HPA017013. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
Submitter comment
ZNF207 has four isoforms. Isoform 1,2 and 4 (Uniprot: [O43670-1]; [O43670-2]; [O43670-4]) mass in around 50-52kDa. Isoform 3 (Uniprot: [O43670-3]) is 41kDa.
Reviewer comment
Doublet seen around expected size.
Submitted by
Denis Salins
Lab
Michael Snyder, Stanford
ZNF207 (Homo sapiens)
Method: immunoprecipitation
Attachment from submitter
Caption
Immunoprecipitation was performed on nuclear extracts from the cell line: HEK293T, using the antibody HPA017013. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 50.8
Submitted by
Nathaniel Watson
Lab
Michael Snyder, Stanford
ZNF207 (Homo sapiens)
Method: immunoprecipitation followed by mass spectrometry
compliant
Caption
IP followed by mass spectrometry. Briefly, protein was immunoprecipitated from K562 nuclear cell lysates using the antibody HPA017013, and the IP fraction was loaded on a 10% polyacrylamide gel (NuPAGEBis-Tris Gel) and separated with an Invitrogen NuPAGE electrophoresis system. The gel was stained by ColloidialCoomassie G-250 stain, gel fragments corresponding to the bands indicated were excised. Then proteins were trypsinized using the in-gel digestion method. Digested proteins were analyzed on an Orbitrap Elite mass spectrometer (Thermo Scientific) by the nanoLC-ESI-MS/MS technique. Peptides were identified by the SEQUEST algorithm and filtered with a high confidence threshold (Peptide false discovery rate < 1%, 2 unique peptides per protein minimum, mass error < 10 ppm).
Submitter comment
TUBB isn't a DNA-binding protein. http://www.uniprot.org/uniprot/Q5ST81
Submitted by
Nathaniel Watson
Lab
Michael Snyder, Stanford
ZNF207 (Homo sapiens)
K562
Method: immunoprecipitation
Attachment from submitter
compliant
Caption
Immunoprecipitation was performed on nuclear extracts from the cell line K562 using the antibody HPA017013. Lane 1: input nuclear lysate. Lane 2: material immunoprecipitated with antibody. Lane 3: material immunoprecipitated using control IgG. Marked bands were excised from gel and subjected to analysis by mass spectrometry. Target molecular weight: 50.8.
Submitted by
Nathaniel Watson
Lab
Michael Snyder, Stanford
ZNF207 (Homo sapiens)
GM12878K562HepG2HeLa-S3MCF-7liver
Method: immunoblot
Attachment from submitter
exempt from standards
Caption
Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order : GM12878, K562, HepG2, HelaS3, MCF7 and Liver using the antibody HPA017013. Molecular mass: 50751 Da
Submitter comment
ZNF207 has four isoforms. Isoform 1,2 and 4 (Uniprot: [O43670-1]; [O43670-2]; [O43670-4]) mass in around 50-52kDa. Isoform 3 (Uniprot: [O43670-3]) is 41kDa.
Reviewer comment
Multiple strong immunoreactive bands seen in all analyzed cell types. Doublet seen in GM12878 is consistent with banding pattern in IPs.
Submitted by
Trupti Kawli
Lab
Michael Snyder, Stanford
ZNF207 (Homo sapiens)
GM12878
Method: immunoprecipitation
Attachment from submitter
exempt from standards
Caption
b) Immunoprecipitation was performed on nuclear extracts from the cell line: GM12878, using the antibody HPA017013 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG. Expected size ~50 kDa.
Submitter comment
ZNF207 has four isoforms. Isoform 1,2 and 4 (Uniprot: [O43670-1]; [O43670-2]; [O43670-4]) mass in around 50-52kDa. Isoform 3 (Uniprot: [O43670-3]) is 41kDa.
Reviewer comment
Doublet seen around expected size.
Submitted by
Trupti Kawli
Lab
Michael Snyder, Stanford