ENCAB000BNS

Antibody against Homo sapiens SATB2

Homo sapiens
K562
partially characterized
Homo sapiens
GM12878, MCF-7, liver, HeLa-S3, HepG2
not characterized to standards
Status
released
Source (vendor)
Sigma
Product ID
HPA029543
Lot ID
R28469
Characterized targets
SATB2 (Homo sapiens)
Host
rabbit
Clonality
polyclonal
Purification
affinity
Isotype
IgG
Antigen description
SATB homeobox 2 recombinant protein epitope signature tag (PrEST)
Antigen sequence
KECPLSQSMISSIVNSTYYANVSATKCQEFGRWYKKYKKIKVERVERENLSDYCVLGQRPMHLPNMNQLASLGKTNEQSPHSQIHHSTPIRNQVPALQPIMSPGLLSPQLSPQLV
External resources

Characterizations

SATB2 (Homo sapiens)
GM12878K562HepG2HeLa-S3MCF-7liver
Method: immunoblot
Attachment from submitter
not compliant
Caption
Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order : GM12878, K562, HepG2, HelaS3, MCF7 and Liver using the antibody HPA029543. Molecular mass: 82555 Da
Reviewer comment
Band is either missing or is not 50% of signal
Submitted by
Trupti Kawli
Lab
Michael Snyder, Stanford
SATB2 (Homo sapiens)
K562
Method: immunoprecipitation
Attachment from submitter
compliant
Caption
b) Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA029543 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG. Expected size ~18 kDa.
Submitted by
Trupti Kawli
Lab
Michael Snyder, Stanford