ENCAB000BNR
Antibody against Homo sapiens SUB1
Homo sapiens
MCF-7
partially characterized
Homo sapiens
GM12878, K562, HepG2, HeLa-S3, liver
not characterized to standards
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA001311
- Lot ID
- R00604
- Characterized targets
- SUB1 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- Activated RNA polymerase II transcriptional coactivator p15 recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- VSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQI
- External resources
Characterizations
SUB1 (Homo sapiens)
GM12878K562HepG2HeLa-S3MCF-7liver
not compliant
- Caption
- Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order : GM12878, K562, HepG2, HelaS3, MCF7 and Liver using the antibody HPA001311. Molecular mass: 14395 Da
- Reviewer comment
- Band is either missing or is not 50% of signal
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- SUB1_HPA001311_WB_a.jpg
SUB1 (Homo sapiens)
MCF-7
compliant
- Caption
- b) Immunoprecipitation was performed on nuclear extracts from the cell line: MCF7, using the antibody HPA001311 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG. Expected size 14-15 kDa.
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- SUB1_HPA001311_WB_b.jpg