ENCAB000BNR

Antibody against Homo sapiens SUB1

Homo sapiens
MCF-7
partially characterized
Homo sapiens
GM12878, HepG2, HeLa-S3, K562, liver
not characterized to standards
Status
released
Source (vendor)
Sigma
Product ID
HPA001311
Lot ID
R00604
Characterized targets
SUB1 (Homo sapiens)
Host
rabbit
Clonality
polyclonal
Purification
affinity
Isotype
IgG
Antigen description
Activated RNA polymerase II transcriptional coactivator p15 recombinant protein epitope signature tag (PrEST)
Antigen sequence
VSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQI
External resources

Characterizations

SUB1 (Homo sapiens)
GM12878K562HepG2HeLa-S3MCF-7liver
Method: immunoblot
Attachment from submitter
not compliant
Caption
Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order : GM12878, K562, HepG2, HelaS3, MCF7 and Liver using the antibody HPA001311. Molecular mass: 14395 Da
Reviewer comment
Band is either missing or is not 50% of signal
Submitted by
Trupti Kawli
Lab
Michael Snyder, Stanford
SUB1 (Homo sapiens)
MCF-7
Method: immunoprecipitation
Attachment from submitter
compliant
Caption
b) Immunoprecipitation was performed on nuclear extracts from the cell line: MCF7, using the antibody HPA001311 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG. Expected size 14-15 kDa.
Submitted by
Trupti Kawli
Lab
Michael Snyder, Stanford