ENCAB000BNQ

Antibody against Homo sapiens SOX6

Homo sapiens
K562
partially characterized
Homo sapiens
HeLa-S3, MCF-7, GM12878, HepG2, liver
not characterized to standards
Status
released
Source (vendor)
Sigma
Product ID
HPA003908
Lot ID
A37311
Characterized targets
SOX6 (Homo sapiens)
Host
rabbit
Clonality
polyclonal
Purification
affinity
Isotype
IgG
Antigen description
Transcription factor SOX-6 recombinant protein epitope signature tag (PrEST)
Antigen sequence
QATSPFACAADGEDAMTQDLTSREKEEGSDQHVASHLPLHPIMHNKPHSEELPTLVSTIQQDADWDSVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEGSRDREIMTSVTFGTPERRKGSLADVVDTLKQKKLEEMTRTEQ
External resources

Characterizations

SOX6 (Homo sapiens)
GM12878K562HepG2HeLa-S3MCF-7liver
Method: immunoblot
Attachment from submitter
not compliant
Caption
Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order : GM12878, K562, HepG2, HelaS3, MCF7 and Liver using the antibody HPA003908. Molecular mass: 91921 Da
Reviewer comment
Band is either missing or is not 50% of signal
Submitted by
Trupti Kawli
Lab
Michael Snyder, Stanford
SOX6 (Homo sapiens)
K562
Method: immunoprecipitation
Attachment from submitter
compliant
Caption
b) Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA003908 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
Submitted by
Trupti Kawli
Lab
Michael Snyder, Stanford