ENCAB000BNQ
Antibody against Homo sapiens SOX6
Homo sapiens
K562
partially characterized
Homo sapiens
GM12878, HepG2, HeLa-S3, MCF-7, liver
not characterized to standards
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA003908
- Lot ID
- A37311
- Characterized targets
- SOX6 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- Transcription factor SOX-6 recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- QATSPFACAADGEDAMTQDLTSREKEEGSDQHVASHLPLHPIMHNKPHSEELPTLVSTIQQDADWDSVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEGSRDREIMTSVTFGTPERRKGSLADVVDTLKQKKLEEMTRTEQ
- External resources
Characterizations
SOX6 (Homo sapiens)
GM12878K562HepG2HeLa-S3MCF-7liver
Method: immunoblot
not compliant
- Caption
- Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order : GM12878, K562, HepG2, HelaS3, MCF7 and Liver using the antibody HPA003908. Molecular mass: 91921 Da
- Reviewer comment
- Band is either missing or is not 50% of signal
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- SOX6_HPA003908_WB_a.jpg
SOX6 (Homo sapiens)
K562
Method: immunoprecipitation
compliant
- Caption
- b) Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA003908 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- SOX6_HPA003908_WB_b.jpg