ENCAB000BNP

Antibody against Homo sapiens KDM6A

Homo sapiens
K562
partially characterized
Homo sapiens
HeLa-S3, HepG2, MCF-7, liver, GM12878
not characterized to standards
Status
released
Source (vendor)
Sigma
Product ID
HPA002111
Lot ID
A47623
Characterized targets
KDM6A (Homo sapiens)
Host
rabbit
Clonality
polyclonal
Purification
affinity
Isotype
IgG
Antigen description
Ubiquitously transcribed X chromosome tetratricopeptide repeat protein (Ubiquitously transcribed TPR protein on the X chromosome)
Antigen sequence
IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT
External resources

Characterizations

KDM6A (Homo sapiens)
GM12878K562HepG2HeLa-S3MCF-7liver
Method: immunoblot
Attachment from submitter
not compliant
Caption
Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order : GM12878, K562, HepG2, HelaS3, MCF7 and Liver using the antibody HPA002111. Molecular mass: 154177 Da
Reviewer comment
Band is either missing or is not 50% of signal
Submitted by
Trupti Kawli
Lab
Michael Snyder, Stanford
KDM6A (Homo sapiens)
K562
Method: immunoprecipitation
Attachment from submitter
compliant
Caption
b) Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA002111 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG. Expected size ~154 kDa.
Submitted by
Trupti Kawli
Lab
Michael Snyder, Stanford