ENCAB000BNN
Antibody against Homo sapiens SIRT1
Homo sapiens
GM12878, K562, HepG2, HeLa-S3, MCF-7, liver
not characterized to standards
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA006295
- Lot ID
- A27910
- Characterized targets
- SIRT1 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- NAD-dependent deacetylase sirtuin-1 recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- IVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSD
- External resources
Characterizations
SIRT1 (Homo sapiens)
GM12878K562HepG2HeLa-S3MCF-7liver
Method: immunoblot
not compliant
- Caption
- Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order : GM12878, K562, HepG2, HelaS3, MCF7 and Liver using the antibody HPA006295. Molecular mass: 81681 Da
- Reviewer comment
- Band is either missing or is not 50% of signal
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- SIRT1_HPA006295_WB_a.jpg
SIRT1 (Homo sapiens)
K562
Method: immunoprecipitation
not compliant
- Caption
- b) Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA006295 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG. Expected size ~81-82 kDa.
- Reviewer comment
- Band is not 50% of total signal
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- SIRT1_HPA006295_WB_b.jpg