ENCAB000BNK
Antibody against Homo sapiens UTY
Homo sapiens
at least one cell type or tissue
not pursued
Homo sapiens
GM12878, K562, HepG2, HeLa-S3, MCF-7, liver, HEK293T
not characterized to standards
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA001165
- Lot ID
- A01107
- Characterized targets
- UTY (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- Ubiquitously transcribed Y chromosome tetratricopeptide repeat protein (Ubiquitously transcribed TPR protein on the Y chromosome).
- Antigen sequence
- SNSCILLDKCPPPRPPTSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNPKNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWRCESNRSHTTI
- External resources
Characterizations
UTY (Homo sapiens)
GM12878
not submitted for review by lab
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: GM12878 using the antibody HPA001165. The image shows western blot analysis of input, flowthrough, immunoprecipitate, and mock immunoprecipitate using IgG. Target molecular weight: 149.5.
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- #1140 GM12878 UTY(HPA001165).jpg
UTY (Homo sapiens)
not submitted for review by lab
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: GM12878, using the antibody HPA001165. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 149.5
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- 1064_10_UTY_HPA001165_GM12878.jpg
UTY (Homo sapiens)
not submitted for review by lab
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: HepG2, using the antibody HPA001165. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 149.5
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- 1064_11_UTY_HPA001165_HepG2.jpg
UTY (Homo sapiens)
not submitted for review by lab
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: MCF-7, using the antibody HPA001165. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 149.5
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- 1064_12_UTY_HPA001165_MCF7.jpg
UTY (Homo sapiens)
HEK293T
not compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: HEK293T, using the antibody HPA001165. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 149.5
- Reviewer comment
- The immunoreactive band runs way higher than expected (>allowed 20% deviation).
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- Expt1119_1-UTY-HPA001165.JPG
UTY (Homo sapiens)
GM12878K562HepG2HeLa-S3MCF-7liver
not compliant
- Caption
- Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order : GM12878, K562, HepG2, HelaS3, MCF7 and Liver using the antibody HPA001165. Molecular mass: 149548 Da
- Reviewer comment
- Major band is at 250 kD rather than 150, and/or is not 50% of signal
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- UTY_HPA001165_WB_a.jpg
UTY (Homo sapiens)
K562
not compliant
- Caption
- b) Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA001165 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
- Reviewer comment
- Strongest band is at 250, UniProt suggests 150KD
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- UTY_HPA001165_WB_b.jpg