ENCAB000BMN
Antibody against Homo sapiens IRF8
Homo sapiens
GM12878
partially characterized
Homo sapiens
K562, HepG2, HeLa-S3, MCF-7, liver
not characterized to standards
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA002531
- Lot ID
- A70819
- Characterized targets
- IRF8 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- Interferon regulatory factor 8 recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- PDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYY
- External resources
Characterizations
IRF8 (Homo sapiens)
GM12878K562HepG2HeLa-S3MCF-7liver
Method: immunoblot
not compliant
- Caption
- Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order : GM12878, K562, HepG2, HelaS3, MCF7 and Liver using the antibody HPA002531. Molecular mass: 48356 Da
- Reviewer comment
- Band is either too faint or is not 50% of signal
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- IRF8_HPA002531_WB_a.jpg
IRF8 (Homo sapiens)
GM12878
Method: immunoprecipitation
compliant
- Caption
- b) Immunoprecipitation was performed on nuclear extracts from the cell line: GM12878, using the antibody HPA002531 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG. Expected size ~48 kDa.
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- IRF8_HPA002531_WB_b.jpg