ENCAB000BML
Antibody against Homo sapiens MTA3
Homo sapiens
K562, MCF-7, HEK293T
characterized to standards
Homo sapiens
any cell type or tissue
partially characterized
Homo sapiens
GM12878, HepG2, HeLa-S3, liver
not characterized to standards
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA039433
- Lot ID
- R36305
- Characterized targets
- MTA3 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- Metastasis associated 1 family, member 3 recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- MPTQSEEEKLSPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTRQA
- External resources
Characterizations
MTA3 (Homo sapiens)
MCF-7
compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: MCF-7, using the antibody HPA039433. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
MTA3 (Homo sapiens)
HepG2
not compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: HepG2, using the antibody HPA039433. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
- Reviewer comment
- Multiple bands and marked band is not >50% of the total signal in the lane. May perhaps be rescued with siRNA knockdown.
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
MTA3 (Homo sapiens)
not submitted for review by lab
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: GM12878, using the antibody HPA039433. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 67.5
- Submitted by
- Denis Salins
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- expt1035_5.jpg
MTA3 (Homo sapiens)
HEK293T
compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line: HEK293T, using the antibody HPA039433. The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.Molecular Weight: 67.5
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- Expt1123_4-MTA3-HPA039433.JPG
MTA3 (Homo sapiens)
K562
compliant
- Caption
- Immunoprecipitation of MTA3 from K562 cells using HPA039433. Lane 1: input nuclear lysate. Lane 2: material immunoprecipitated with HPA039433. Lane 3: material immunoprecipitated using control IgG. Band A was excised from gel and subject to analysis by mass spectrometry. The expected band size is 67.5 kDa.
- Submitted by
- Kathrina Onate
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- MTA3.jpeg
MTA3 (Homo sapiens)
K562
compliant
- Caption
- Immunoprecipitation was performed on nuclear extracts from the cell line K562 using the antibody HPA039433. Lane 1: input nuclear lysate. Lane 2: material immunoprecipitated with antibody. Lane 3: material immunoprecipitated using control IgG. Marked bands were excised from gel and subjected to analysis by mass spectrometry. Target molecular weight: 67.5.
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- MTA3.jpeg
MTA3 (Homo sapiens)
compliant
- Caption
- IP followed by mass spectrometry: Briefly, protein was immunoprecipitated from K562 nuclear cell lysates using HPA039433, and the IP fraction was loaded on a 10% polyacrylamide gel (NuPAGEBis-Tris Gel) and separated with an Invitrogen NuPAGE electrophoresis system. The gel was stained by ColloidialCoomassie G-250 stain, gel fragments corresponding to the bands indicated were excised. Then proteins were trypsinized using the in-gel digestion method. Digested proteins were analyzed on an Orbitrap Elite mass spectrometer (Thermo Scientific) by the nanoLC-ESI-MS/MS technique. Peptides were identified by the SEQUEST algorithm and filtered with a high confidence threshold (Peptide false discovery rate < 1%, 2 unique peptides per protein minimum, mass error < 10 ppm).
- Submitter comment
- Both MTA3 and DHX9 have interaction with AURKA, and DHX9 has interaction with HNRNPR and HNRNPC. http://thebiogrid.org/121568/summary/homo-sapiens/mta3.html http://thebiogrid.org/108025/summary/homo-sapiens/dhx9.html
- Submitted by
- Kathrina Onate
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- MTA3_HPA039433 final.pdf
MTA3 (Homo sapiens)
compliant
- Caption
- IP followed by mass spectrometry. Briefly, protein was immunoprecipitated from K562 nuclear cell lysates using the antibody HPA039433, and the IP fraction was loaded on a 10% polyacrylamide gel (NuPAGEBis-Tris Gel) and separated with an Invitrogen NuPAGE electrophoresis system. The gel was stained by ColloidialCoomassie G-250 stain, gel fragments corresponding to the bands indicated were excised. Then proteins were trypsinized using the in-gel digestion method. Digested proteins were analyzed on an Orbitrap Elite mass spectrometer (Thermo Scientific) by the nanoLC-ESI-MS/MS technique. Peptides were identified by the SEQUEST algorithm and filtered with a high confidence threshold (Peptide false discovery rate < 1%, 2 unique peptides per protein minimum, mass error < 10 ppm).
- Submitter comment
- None of WTAP, FUS and DLST are DNA binding proteins
- Reviewer comment
- Highest ranking transcription factor
- Submitted by
- Nathaniel Watson
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
MTA3 (Homo sapiens)
GM12878K562HepG2HeLa-S3MCF-7liver
not compliant
- Caption
- Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order : GM12878, K562, HepG2, HelaS3, MCF7 and Liver using the antibody HPA039433. Molecular mass: 67504 Da
- Reviewer comment
- Band is not 50% of overall signal
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- MTA3_HPA039433_WB_a.jpg
MTA3 (Homo sapiens)
K562
compliant
- Caption
- b) Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA039433 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- MTA3_HPA039433_WB_b.jpg