ENCAB000BLZ
Antibody against Homo sapiens NFATC2
Homo sapiens
HepG2, MCF-7
partially characterized
Homo sapiens
GM12878, K562, HeLa-S3, liver
not characterized to standards
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA008789
- Lot ID
- A33084
- Characterized targets
- NFATC2 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- Nuclear factor of activated T-cells, cytoplasmic 2 recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- DFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPV
- External resources
Characterizations
NFATC2 (Homo sapiens)
GM12878K562HepG2HeLa-S3MCF-7liver
Method: immunoblot
compliant
- Caption
- Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order : GM12878, K562, HepG2, HelaS3, MCF7 and Liver using the antibody HPA008789. Molecular mass: 100146 Da
- Reviewer comment
- Band is either too faint (lanes 4 and 6) or is not 50% of signal(Lanes 1 and 2). Lanes 3 and 5 a re complient
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- NFATC2_HPA008789_WB_a.jpg
NFATC2 (Homo sapiens)
K562
Method: immunoprecipitation
not compliant
- Caption
- b) Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA008789 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG. Expected size ~100 kDa.
- Reviewer comment
- Band not within 20% of expected size
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- NFATC2_HPA008789_WB_b.jpg