ENCAB000BLY
Antibody against Homo sapiens MLLT10
Homo sapiens
at least one cell type or tissue
not pursued
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA005747
- Lot ID
- R04461
- Characterized targets
- MLLT10 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- Protein AF-10 recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGYKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSV
- External resources
Characterizations
MLLT10 (Homo sapiens)
not submitted for review by lab
- Caption
- a) Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order: GM12878, K562, Hela S3, HepG2, IMR90, A549, Heart using the antibody HPA005747
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- MLLT10_HPA005747_WB.jpg