ENCAB000BLW
Antibody against Homo sapiens MAFB
Homo sapiens
GM12878
partially characterized
Homo sapiens
K562, HepG2, HeLa-S3, MCF-7, liver
not characterized to standards
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA005653
- Lot ID
- A31532
- Characterized targets
- MAFB (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- Transcription factor MafB recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- MEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQPLQSFDSFRGAHHHHHHHHPH
- External resources
Characterizations
MAFB (Homo sapiens)
GM12878K562HepG2HeLa-S3MCF-7liver
Method: immunoblot
compliant
- Caption
- Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order : GM12878, K562, HepG2, HelaS3, MCF7 and Liver using the antibody HPA005653. Molecular mass: 35792 Da
- Reviewer comment
- Band is either missing (lane 1_ or is not 50% of signal (lanes 3, 4, 5, and 6). Lane 2 is compliant.
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- MAFB_HPA005653_WB_a.jpg
MAFB (Homo sapiens)
K562
Method: immunoprecipitation
not compliant
- Caption
- b) Immunoprecipitation was performed on nuclear extracts from the cell line: K562, using the antibody HPA005653 .The blot shows western blot analysis of input, flowthrough, immunoprecipitate and mock immunoprecipitate using IgG.
- Reviewer comment
- No protein size, not clear picture of the gel, lack details
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- MAFB_HPA005653_WB_b.jpg