ENCAB000BLV
Antibody against Homo sapiens CEBPE
Homo sapiens
at least one cell type or tissue
not pursued
- Status
- released
- Source (vendor)
- Sigma
- Product ID
- HPA002928
- Lot ID
- R00321
- Characterized targets
- CEBPE (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- CCAAT/enhancer-binding protein epsilon recombinant protein epitope signature tag (PrEST)
- Antigen sequence
- SHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPR
- External resources
Characterizations
CEBPE (Homo sapiens)
Method: immunoblot
not submitted for review by lab
- Caption
- a) Western blot analysis of nuclear lysates prepared from multiple cells lines loaded in the order: GM12878, K562, Hela S3, HepG2, IMR90, A549, Heart using the antibody HPA002928
- Submitted by
- Trupti Kawli
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG006996
- Download
- CEBPE_HPA002928_WB.jpg