ENCAB000AWY
Antibody against Homo sapiens SRSF1
Homo sapiens
at least one cell type or tissue
not pursued
- Status
- released
- Source (vendor)
- Aviva
- Product ID
- ARP40691_P050
- Lot ID
- QC9710-100609
- Characterized targets
- SRSF1 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- affinity
- Isotype
- IgG
- Antigen description
- The immunogen is a synthetic peptide directed towards the C terminal region of human SFRS1
- Antigen sequence
- EFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR
- External resources
Characterizations
SRSF1 (Homo sapiens)
not submitted for review by lab
- Caption
- Western blot analysis of lysates from HeLa cells using rabbit polyclonal to SRSF1
- Submitted by
- Taiki Tsutsui
- Lab
- Xiang-Dong Fu, UCSD
- Grant
- U54HG007005
- Download
- SRSF1_aviva-1_WB_HeLa_Fu.png