ENCAB000AWR
Antibody against Homo sapiens RALYL
Homo sapiens
at least one cell type or tissue
not pursued
- Status
- released
- Source (vendor)
- Aviva
- Product ID
- ARP41176_P050
- Lot ID
- QC21044
- Characterized targets
- RALYL (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Isotype
- IgG
- Antigen sequence
- AQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFD
- External resources
Characterizations
RALYL (Homo sapiens)
Method: immunoblot
not submitted for review by lab
- Caption
- Western blot analysis of lysates from HeLa cells using rabbit polyclonal to RALYL
- Submitted by
- Taiki Tsutsui
- Lab
- Xiang-Dong Fu, UCSD
- Grant
- U54HG007005
- Download
- RALYL_aviva-1_WB_HeLa_Fu.png