ENCAB000AWA
Antibody against Homo sapiens HNRNPLL
Homo sapiens
at least one cell type or tissue
not pursued
- Status
- released
- Source (vendor)
- Aviva
- Product ID
- ARP41102_T100
- Lot ID
- QC10120-091020
- Characterized targets
- HNRNPLL (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Purification
- Protein A
- Isotype
- IgG
- Antigen description
- The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPLL
- Antigen sequence
- RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS
- External resources
Characterizations
HNRNPLL (Homo sapiens)
not submitted for review by lab
- Caption
- Western blot analysis of lysates from HeLa cells using rabbit polyclonal to HNRNPLL
- Submitted by
- Taiki Tsutsui
- Lab
- Xiang-Dong Fu, UCSD
- Grant
- U54HG007005
- Download
- hnRNPLL_aviva-1_WB_HeLa_Fu.png