ENCAB000AVT
Antibody against Homo sapiens HNRNPH1
Homo sapiens
HepG2, K562
characterized to standards
Homo sapiens
HeLa-S3
not characterized to standards
- Status
- released
- Source (vendor)
- Aviva
- Product ID
- ARP58479_P050
- Lot ID
- QC25591
- Characterized targets
- HNRNPH1 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Isotype
- IgG
- Antigen description
- A synthetic peptide directed towards the middle region of human HNRNPH1
- Antigen sequence
- FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG
- External resources
Characterizations
HNRNPH1 (Homo sapiens)
compliant
- Caption
- Western blot following CRISPR against HNRNPH1 in HepG2 whole cell lysate using HNRNPH1 specific antibody. Lane 1 is a ladder, lane 2 is HepG2 non-targeting control knockdown, lane 3 and 4 are two different CRISPR against HNRNPH1. HNRNPH1 protein appears as the green arrow, Beta-actin serves as a control and appears in red arrow.
- Submitted by
- Xintao Wei
- Lab
- Brenton Graveley, UConn
- Grant
- U41HG009889
- Download
- HNRNPH1-HEPG2-CRISPR.png
HNRNPH1 (Homo sapiens)
HeLa-S3
not compliant
- Caption
- Immunoprecipitation from HeLa whole cell lysate and analized by western blot analysis uisng rabbit polyclonal to HNRNPH1
- Submitter comment
- There are multiple immunoreactive bands and the marked band does not contain at least 50% of the total signal in the lane.
- Submitted by
- Taiki Tsutsui
- Lab
- Xiang-Dong Fu, UCSD
- Grant
- U54HG007005
- Download
- hnRNPH1_aviva_IP-WB_HeLa_Fu.png
HNRNPH1 (Homo sapiens)
HepG2
compliant
- Caption
- IP-Western Blot analysis of HepG2 whole cell lysate using HNRNPH1 specific antibody. Lane 1 is 3% of ten million whole cell lysate input (lane under '15% input') , lane 2 is 20% of IP enrichment using rabbit normal IgG (lane under 'IgG') and lane 3 is 20% IP enrichment using rabbit polyclonal anti-HNRNPH1 antibody (lanes under 'anti-HNRNPH1'). Asterisk indicates heavy chain of antibody.
- Submitted by
- Marcus Ho
- Lab
- Xiang-Dong Fu, UCSD
- Grant
- U54HG007005
- Download
- HNRNPH1_HepG2.png
HNRNPH1 (Homo sapiens)
K562
compliant
- Caption
- IP-Western Blot analysis of K562 whole cell lysate using HNRNPH1 specific antibody. Lane 1 is 3% of ten million whole cell lysate input (lane under '15% input') , lane 2 is 20% of IP enrichment using rabbit normal IgG (lane under 'IgG') and lane 3 is 20% IP enrichment using rabbit polyclonal anti-HNRNPH1 antibody (lanes under 'anti-HNRNPH1'). Asterisk indicates heavy chain of antibody.
- Submitted by
- Marcus Ho
- Lab
- Xiang-Dong Fu, UCSD
- Grant
- U54HG007005
- Download
- HNRNPH1_K562.png