ENCAB000AVT

Antibody against Homo sapiens HNRNPH1

Homo sapiens
K562, HepG2
characterized to standards
Homo sapiens
HeLa-S3
not characterized to standards
Status
released
Source (vendor)
Aviva
Product ID
ARP58479_P050
Lot ID
QC25591
Characterized targets
HNRNPH1 (Homo sapiens)
Host
rabbit
Clonality
polyclonal
Isotype
IgG
Antigen description
A synthetic peptide directed towards the middle region of human HNRNPH1
Antigen sequence
FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG
External resources

Characterizations

HNRNPH1 (Homo sapiens)
Method: knockdown or knockout
Attachment from submitter
compliant
Caption
Western blot following CRISPR against HNRNPH1 in K562 whole cell lysate using HNRNPH1 specific antibody. Lane 1 is a ladder, lane 2 is K562 non-targeting control knockdown, lane 3 and 4 are two different CRISPR against HNRNPH1.HNRNPH1 protein appears as the green band, GAPDH serves as a control and appears in red.
Submitted by
Xintao Wei
Lab
Brenton Graveley, UConn
HNRNPH1 (Homo sapiens)
HeLa-S3
Method: immunoprecipitation
Attachment from submitter
not compliant
Caption
Immunoprecipitation from HeLa whole cell lysate and analized by western blot analysis uisng rabbit polyclonal to HNRNPH1
Submitter comment
There are multiple immunoreactive bands and the marked band does not contain at least 50% of the total signal in the lane.
Submitted by
Taiki Tsutsui
Lab
Xiang-Dong Fu, UCSD
HNRNPH1 (Homo sapiens)
HepG2
Method: immunoprecipitation
Attachment from submitter
compliant
Caption
IP-Western Blot analysis of HepG2 whole cell lysate using HNRNPH1 specific antibody. Lane 1 is 3% of ten million whole cell lysate input (lane under '15% input') , lane 2 is 20% of IP enrichment using rabbit normal IgG (lane under 'IgG') and lane 3 is 20% IP enrichment using rabbit polyclonal anti-HNRNPH1 antibody (lanes under 'anti-HNRNPH1'). Asterisk indicates heavy chain of antibody.
Submitted by
Marcus Ho
Lab
Xiang-Dong Fu, UCSD
HNRNPH1 (Homo sapiens)
K562
Method: immunoprecipitation
Attachment from submitter
compliant
Caption
IP-Western Blot analysis of K562 whole cell lysate using HNRNPH1 specific antibody. Lane 1 is 3% of ten million whole cell lysate input (lane under '15% input') , lane 2 is 20% of IP enrichment using rabbit normal IgG (lane under 'IgG') and lane 3 is 20% IP enrichment using rabbit polyclonal anti-HNRNPH1 antibody (lanes under 'anti-HNRNPH1'). Asterisk indicates heavy chain of antibody.
Submitted by
Marcus Ho
Lab
Xiang-Dong Fu, UCSD