ENCAB000AVB
Antibody against Homo sapiens HNRNPA2B1
Homo sapiens
HeLa-S3
not characterized to standards
- Status
- released
- Source (vendor)
- Aviva
- Product ID
- ARP41035_P050
- Lot ID
- QC21057
- Characterized targets
- HNRNPA2B1 (Homo sapiens)
- Host
- rabbit
- Clonality
- polyclonal
- Isotype
- IgG
- Antigen sequence
- MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDC
- External resources
Characterizations
HNRNPA2B1 (Homo sapiens)
HeLa-S3
not compliant
- Caption
- Western blot analysis of lysates from HeLa cells using rabbit polyclonal to HNRNPA2B1. Expected size: 37kDa
- Reviewer comment
- There are multiple immunoreactive bands and the marked band does not contain at least 50% of the total signal in the lane. May possibly be rescued by a knockdown secondary characterization.
- Submitted by
- Taiki Tsutsui
- Lab
- Xiang-Dong Fu, UCSD
- Grant
- U54HG007005
- Download
- hnRNPA2B1_aviva_WB_HeLa_Fu.png