ENCAB000AMV
Antibody against Homo sapiens ZNF274
Homo sapiens
at least one cell type or tissue
awaiting characterization
Homo sapiens
Panc1, MCF-7, K562, HepG2, HeLa-S3, HCT116, GM12878, GM08714
partially characterized
- Status
- released
- Source (vendor)
- Abnova
- Product ID
- H00010782-M01
- Lot ID
- 08064-4C12
- Characterized targets
- ZNF274 (Homo sapiens)
- Host
- mouse
- Clonality
- monoclonal
- Purification
- affinity
- Isotype
- IgG2bκ
- Antigen description
- Raised against a partial recombinant ZNF274 (corresponding to amino acids 420-531 of the human ZNF274 protein).
- Antigen sequence
- QKIDNPESQANSGALDTNQVLLHKIPPRKRLRKRDSQVKSMKHNSRVKIHQKSCERQKAKEGNGCRKTFSRSTKQITFIRIHKGSQVCRCSECGKIFRNPRYFSVHKKIHT
- External resources
Characterizations
ZNF274 (Homo sapiens)
not reviewed
- Caption
- Overlap of ZNF274 ChIP-seq peaks from two different antibodies. ChIP-seq was performed in GM12878 cells using two different ZNF274 antibodies and peaks were called using the Solesearch ChIP-seq peak calling program. The ENCODE 40% rule was applied to determine the overlap between the two datasets. The list from Antibody 2 (anti-ZNF274 (M01)) was truncated to the same size as Antibody 1 and the top 40% peaks from either dataset were compared to the lists. As shown in the figure, there is greater than 90% overlap of the top 40% peaks.
- Submitted by
- Peggy Farnham
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG004558
ZNF274 (Homo sapiens)
not reviewed
- Caption
- Immunoprecipitation of ZNF274 from K562 nuclear extracts. 3ug of the anti-ZNF274 (M01) antibody was used to immunoprecipitate ZNF274 from 100 ug of nuclear extracts prepared from K562 cells. 5ug of input lysate (5% of each IP reaction) and the entire eluate from the ZNF274 and control IgG IPs were analyzed by SDS-PAGE and Western blottling using the anti-ZNF274 (M01) antibody at a 1:500 dilution (2 ug/mL). As shown in the blot, the anti-ZNF274 (M01) antibody specifically precipitates an ~ 90kDa band.
- Submitted by
- Peggy Farnham
- Lab
- Michael Snyder, Stanford
- Grant
- U54HG004558
ZNF274 (Homo sapiens)
Panc1MCF-7K562HepG2HeLa-S3HCT116GM12878GM08714
compliant
- Caption
- ZNF274 (420-530) mAb Abnova# H00010782-M01 mouse monoclonal Lot# 08064-4C12. Expected Protein Size: 74 kDa. 40ug of Nuclear Extract used as Input in Western Blot for the following cell lines: 1: PANC1, 2: MCF7, 3: K562, 4: HepG2, 5: HeLa, 6: HCT116, 7: GM12878, 8: GM08714 (ICF)
- Submitted by
- Heather Witt
- Lab
- Peggy Farnham, USC
- Grant
- U54HG006996