1. Antibodies
  2. Homo sapiens
  3. ZNF274

ENCAB000AMU

Antibody against Homo sapiens ZNF274

Homo sapiens
at least one cell type or tissue
awaiting characterization
Status
released
Source (vendor)
Abnova
Product ID
H00010782-A01
Lot ID
060729QCS1
Characterized targets
ZNF274 (Homo sapiens)
Host
mouse
Clonality
polyclonal
Antigen description
Raised against a partial recombinant ZNF274 (GST-fusion of a.a.420-531 of human ZNF274 protein).
Antigen sequence
QKIDNPESQANSGALDTNQVLLHKIPPRKRLRKRDSQVKSMKHNSRVKIHQKSCERQKAKEGNGCRKTFSRSTKQITFIRIHKGSQVCRCSECGKIFRNPRYFSVHKKIHT

Characterizations

ZNF274 (Homo sapiens)
Method: immunoblot
Attachment PDF Icon
not reviewed
Caption
ZNF274 antibody: Novus Biologicals mouse polyclonal anti-ZNF274 antibody H00010782-A01 A. Western blot using 30 ug Nuclear Extract from ENCODE cell-lines. B. Depletion of ZNF274 by siRNA transfection. Three different siRNAs targeting ZNF274 and two control siRNAs were transfected into HelaS3 cells at a final concentration of 40nM. Western blots against ZNF274 and NUP107 as a loading control. C. Immunoprecipitation of ZNF274 from K562 nuclear extracts. The ZNF274 antibody immunoprecipitated a major 90kDa band that was not precipitated by the control IgG. D. ChIP analysis of ZNF274 in siZNF274 transfected and siCONTROL transfected Hela cells. The ZNF274 ChIP signals are reduced in Hela cell transfected with siZNF274 siRNAs compared to cells transfected with siCONTROL siRNAs. For ZNF274 knockdown RNA analysis, HeLa or K562 cells (cells were grown under the ENCODE standard HeLa or K562 cell growth protocols) were transfected with 40 nM ZNF274 siRNAs (Stealth Select RNAi; Invitrogen, HSS116638;HSS116639;HSS116640) or si-GLO RISC-Free (Dharmacon, cat# D-001600-01) as a non-specific control using Invitrogen Lipofectamine2000 according to manufacture recommendations. Cells were transfected, retransfected 48 h later and harvested at 96 h following the initial transfection for collection of protein or chromatin; protein was extracted with ice-cold RIPA buffer containing a protease inhibitor cocktail and chromatin was prepared using standard ChIP-seq chromatin preparation methods.
Submitted by
Peggy Farnham
Lab
Michael Snyder, Stanford
ZNF274 (Homo sapiens)
Method: immunoprecipitation
Attachment PDF Icon
not reviewed
Caption
ZNF274 antibody: Novus Biologicals mouse polyclonal anti-ZNF274 antibody H00010782-A01 A. Western blot using 30 ug Nuclear Extract from ENCODE cell-lines. B. Depletion of ZNF274 by siRNA transfection. Three different siRNAs targeting ZNF274 and two control siRNAs were transfected into HelaS3 cells at a final concentration of 40nM. Western blots against ZNF274 and NUP107 as a loading control. C. Immunoprecipitation of ZNF274 from K562 nuclear extracts. The ZNF274 antibody immunoprecipitated a major 90kDa band that was not precipitated by the control IgG. D. ChIP analysis of ZNF274 in siZNF274 transfected and siCONTROL transfected Hela cells. The ZNF274 ChIP signals are reduced in Hela cell transfected with siZNF274 siRNAs compared to cells transfected with siCONTROL siRNAs. For ZNF274 knockdown RNA analysis, HeLa or K562 cells (cells were grown under the ENCODE standard HeLa or K562 cell growth protocols) were transfected with 40 nM ZNF274 siRNAs (Stealth Select RNAi; Invitrogen, HSS116638;HSS116639;HSS116640) or si-GLO RISC-Free (Dharmacon, cat# D-001600-01) as a non-specific control using Invitrogen Lipofectamine2000 according to manufacture recommendations. Cells were transfected, retransfected 48 h later and harvested at 96 h following the initial transfection for collection of protein or chromatin; protein was extracted with ice-cold RIPA buffer containing a protease inhibitor cocktail and chromatin was prepared using standard ChIP-seq chromatin preparation methods.
Submitted by
Peggy Farnham
Lab
Michael Snyder, Stanford